PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.11G227800.2.p | ||||||||
Common Name | GLYMA_11G227800, LOC100800233 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 180aa MW: 20473.8 Da PI: 7.5082 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 66.1 | 4.8e-21 | 27 | 88 | 1 | 57 |
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++ R+++t+eq+++L elF + r+ps++++++++++l +++ ++V++WFqN++a+e++ Glyma.11G227800.2.p 27 KCGRWNPTTEQVKVLTELFSSgLRTPSTDQIQKISNQLsfygKIESKNVFYWFQNHKARERQ 88 568*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 114.1 | 7.1e-37 | 27 | 90 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 ++ RW+Pt+eQ+k+L+el++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+ Glyma.11G227800.2.p 27 KCGRWNPTTEQVKVLTELFSSGLRTPSTDQIQKISNQLSFYGKIESKNVFYWFQNHKARERQKR 90 678***********************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.965 | 24 | 89 | IPR001356 | Homeobox domain |
SMART | SM00389 | 4.5E-4 | 26 | 93 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 3.9E-18 | 28 | 88 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 8.98E-12 | 29 | 91 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-8 | 30 | 88 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.04E-5 | 30 | 90 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MEEGMSEFFS SGVSVGGNSG SATTGTKCGR WNPTTEQVKV LTELFSSGLR TPSTDQIQKI 60 SNQLSFYGKI ESKNVFYWFQ NHKARERQKR RKVDKDVIRS ENSISINSFT QNFNQLYQVS 120 EPERVIETLQ LFPLNSFGES ESKNMRVHAS DQCRDSTMFS YTVGEQMDHP PLDLRLSFM* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Specifically expressed in the hypophysis of the majority of early globular embryos, approximately one round of cell division after the 16-cell stage, but never at the 16-cell stage itself. After the division of the hypophysis, it is detected in the upper lens-shaped cell that gives rise to the QC, but not in the lower daughter cell that gives rise to the central root cap. Subsequently, in heart stage and bent cotyledon stage embryos, it is detected in the four cells of the QC, which are the direct descendants of the lens-shaped cell. Also expressed in patches of cells that appeared associated with the vascular primordium of the cotyledons. This expression is strongest in late heart stage embryos and then gradually decreases. {ECO:0000269|PubMed:14711878}. | |||||
Uniprot | TISSUE SPECIFICITY: Specifically expressed in the central cells of a quiescent center (QC) of the root. {ECO:0000269|PubMed:14711878}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor, which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:25631790}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.11G227800.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015037 | 1e-107 | AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003537483.1 | 1e-132 | WUSCHEL-related homeobox 5 | ||||
Swissprot | Q8H1D2 | 2e-59 | WOX5_ARATH; WUSCHEL-related homeobox 5 | ||||
TrEMBL | K7LRQ0 | 1e-131 | K7LRQ0_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA11G34990.1 | 1e-129 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G11260.1 | 3e-60 | WUSCHEL related homeobox 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.11G227800.2.p |
Entrez Gene | 100800233 |