|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Glyma.11G156200.1.p |
Common Name | GLYMA_11G156200 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
Family |
GATA |
Protein Properties |
Length: 157aa MW: 17612.7 Da PI: 8.7815 |
Description |
GATA family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Glyma.11G156200.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GATA | 54.8 | 1.3e-17 | 76 | 110 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+nC tt plWR+gp g+k+LCnaCG++++k+++
Glyma.11G156200.1.p 76 CANCDTTYNPLWRNGPHGPKSLCNACGIRFKKEER 110
********************************986 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0030154 | Biological Process | cell differentiation |
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter |
GO:0005634 | Cellular Component | nucleus |
GO:0005667 | Cellular Component | transcription factor complex |
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding |
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding |
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding |
GO:0003682 | Molecular Function | chromatin binding |
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
Protein Sequence Length: 157 aa
Download sequence Send
to blast |
MTLITPSSSS SVDCTLSLGT PSTRFSKYEE KRSCHERRSV SNFCWDLLQS KHNNPQSHSK 60 SSQITNTTDP VLVHRCANCD TTYNPLWRNG PHGPKSLCNA CGIRFKKEER RASAATAKMQ 120 CFSPRMGNEF RFMDDADRVT ADNGISFLSW RLNVTD*
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: In the developing axillary shoot apical meristem (SAM), expressed at the boundary between nascent axillary meristems and the adaxial side of leaves. In all mature SAMs, located at the boundaries between the central SAM and the initiating organ primordia, as well as between the neighboring initiating organ primordia. In the floral meristem, strongly expressed at the boundaries between the meristematic dome and the initiating floral organ primordia, and also at the boundaries between the primordia of different whorls. Expression at the boundaries attenuates as the organ primordia grow apart. In flowers, localized at the boundary between the central meristematic cells and differentiating stamen primordia to later accumulates at the medial ridge region of the carpel. Highly expressed in the developing anthers, in both the tapetum cell layer and microsporocytes. In developing ovules, confined to inner and outer integuments. In aerial tissues, strongly present in phloem tissues (PubMed:15367721). First observed in the whole embryo, but later confined to the center cells of the embryo and provascular tissues (PubMed:15367721, PubMed:20643354). {ECO:0000269|PubMed:15367721, ECO:0000269|PubMed:20643354}. |
Uniprot | TISSUE SPECIFICITY: Expressed in vegetative and inflorescence shoot apical meristems (SAMs), axillary (SAMs), floral meristems, developing ovules and stamens, vascular tissues, and in the embryo. {ECO:0000269|PubMed:15367721, ECO:0000269|PubMed:26390296}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcriptional factor that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters (including its own promoter and GATA21 promoter), thus regulating the expression of genes mostly involved in hormone responses and floral organ specification (including genes regulating hormones responses) (PubMed:23335616, PubMed:26390296). Regulates both flower and shoot apical meristem (SAM) development, especially for establishing organ boundaries in shoots and flowers, probably by controlling the number and position of WUS-expressing cells (PubMed:15367721, PubMed:23335616). Coregulates, with AGO10/PNH, the shoot apical meristem (SAM) organization. Regulates floral organ development via the promotion of JAG and NPR5/BOP2 expression. Modulates cytokinin homeostasis in organ boundaries by regulating CKX3 expression (PubMed:26390296). Involved in cell proliferation and differentiation (PubMed:15367721). Required to position the inductive proembryo boundary via the regulation of gene expression and for early embryonic development (PubMed:20643354). Together with GIF1/AN3, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression (PubMed:22669825). {ECO:0000269|PubMed:15367721, ECO:0000269|PubMed:20643354, ECO:0000269|PubMed:22669825, ECO:0000269|PubMed:23335616, ECO:0000269|PubMed:26390296}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Repressed via a negative regulatory feedback loop. {ECO:0000269|PubMed:23335616}. |