PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G138600.1.p
Common NameGLYMA_11G138600, LOC100796903
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 743aa    MW: 83852.9 Da    PI: 5.5571
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G138600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.79.5e-1143697391373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lL+ cA+avss+d   a++lL++++++asp gd +qRla++f+ AL+arl+++++++y al+ ++ts    ++ ++a++++  ++P+
  Glyma.11G138600.1.p 369 LRTLLILCAQAVSSDDRMSANELLKQIKQHASPLGDGTQRLAQCFASALEARLVGTGTQIYTALSHKRTS---AADMVKAYQMYISACPF 455
                          5789************************************************************999999...99*************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           k+s + aN++Il  +++ e++HiiDf+i +G+QWpaL+  L+++p+gpp+lRiTg++ p++g   +e+++etg rL++++++++vpfef
  Glyma.11G138600.1.p 456 KKLSMIFANHTILHLAKEVETLHIIDFGIRYGFQWPALIYRLSKQPGGPPKLRITGIELPQPGfrPAERVQETGLRLTRYCDRFNVPFEF 545
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ +a+++e++++e+L++k++E l+ n +++ ++llde+v ++s+rd+vLkl+++ +P ++ +++ + ++n++ F++rf eal +ys+lf
  Glyma.11G138600.1.p 546 NA-IAQKWETIKIEDLKIKENELLVANAMFRFQNLLDETVVVNSPRDAVLKLIRKANPAIFLHANVNGSYNAPFFVTRFREALFHYSTLF 634
                          **.7************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d l+++++ e+  r + Ere++gr+++n+vaceg er+er et+++W+ r ++aGFk++pl+++  ++ ++ l+  +   +++ e+++ +
  Glyma.11G138600.1.p 635 DVLDTNVACEDPMRLMFEREFFGRQVMNIVACEGCERVERPETYKQWQVRNMRAGFKQLPLDKHLINKLRCKLKDAYHSDFMLLEDDNYM 724
                          *****************************************************************************777********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r +++ S+W
  Glyma.11G138600.1.p 725 LQGWKGRVVYASSCW 739
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.58343720IPR005202Transcription factor GRAS
PfamPF035143.3E-111369739IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MDPHLKSNFI NGVKPSQVPN TVDVEDHSFD PVNGMMKPFD FGFMDNRFLI SPDPNAAQNP  60
FSSSTDEDYP LDEIDFSATV LRYINQMLME EDLEAKPCMF HDTLALQAAE KSFYEVIGET  120
YHSSSIQNYH NMDSPDESSF SGATTSTSNS FESQWNNVDL ADYKPSILQT TFPADFVFQA  180
SSIQSSMNTT SNFAVTNSQF LASSVAGFLD PGSTNLFSKS ESVLQFERGV EEANKFLPKW  240
NPLVFDLENP SFRMVPPQQV KIKAETERDE ISAESRGRKN HEREDEEADL QDGRSNKQSA  300
VYIDDSEISE LLDKVLLGTG CRNEQAPSCI GHADLPNGPS LGKLEETNKS GGGKSHVKKQ  360
GSKKEIVDLR TLLILCAQAV SSDDRMSANE LLKQIKQHAS PLGDGTQRLA QCFASALEAR  420
LVGTGTQIYT ALSHKRTSAA DMVKAYQMYI SACPFKKLSM IFANHTILHL AKEVETLHII  480
DFGIRYGFQW PALIYRLSKQ PGGPPKLRIT GIELPQPGFR PAERVQETGL RLTRYCDRFN  540
VPFEFNAIAQ KWETIKIEDL KIKENELLVA NAMFRFQNLL DETVVVNSPR DAVLKLIRKA  600
NPAIFLHANV NGSYNAPFFV TRFREALFHY STLFDVLDTN VACEDPMRLM FEREFFGRQV  660
MNIVACEGCE RVERPETYKQ WQVRNMRAGF KQLPLDKHLI NKLRCKLKDA YHSDFMLLED  720
DNYMLQGWKG RVVYASSCWV PA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A7e-533527411379Protein SCARECROW
5b3h_D7e-533527411379Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G138600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539083.10.0scarecrow-like protein 14 isoform X1
RefseqXP_028189930.10.0scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A445I1840.0A0A445I184_GLYSO; Scarecrow-like protein 14
TrEMBLK7LPN10.0K7LPN1_SOYBN; Uncharacterized protein
STRINGGLYMA11G14750.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]