PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G138500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 670aa    MW: 76038.4 Da    PI: 5.3454
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G138500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS344.91.4e-1052956661373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl cA+ v ++d + a++lL+++++++s  gd+ qRl++yf+++L++ l + +++        ++++ + +e l+ + +f  +sP+
  Glyma.11G138500.1.p 295 LRNLLLMCAQSVYANDSRTANELLKQIRQHSSAIGDASQRLVHYFANGLKTCLIGDGTGAQGMYFFLTSKKITAAEFLTTYLVFLSASPF 384
                          689****************************************************88888777777777777799*************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf h+ aN++I++a++++e+vH+iDf+i +G+Q p+L++ L++R++gpp+lRiTg++ p++g   +e++eetg+ La+++++ +vpfe+
  Glyma.11G138500.1.p 385 KKFIHFFANKMIMKAAAKAETVHVIDFGILYGFQCPSLIKFLSNRESGPPKLRITGIEFPQPGfrPTERIEETGHCLANYCKHYNVPFEY 474
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n++++k+ e++++e+L+++++E +aVn++l+ ++ll+es +++s+r++vL+l+++++ ++++ +  + ++n++ F++rf eal +ysa +
  Glyma.11G138500.1.p 475 NAIASKNRESIQVEALKIQSNELVAVNCHLRFENLLNESIEVNSPRNAVLHLIRKINQDIFTQSITNGSYNAPFFATRFREALFHYSATY 564
                          ***999************************************************************************************ PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          + +++ +pre+e+r ++Erellgrei+nv+aceg++r+er et+++W+ r ++aGFk++pl+e+ +++ ++   +++   + ++e++++l
  Glyma.11G138500.1.p 565 ELIDTVIPRENEWRLMIERELLGREIMNVIACEGSQRIERPETYKQWQVRNTRAGFKKLPLNEELMAKLRTANGTTD---FVLDEDNNWL 651
                          ****************************************************************9988776655555...********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk++ L++ ++W
  Glyma.11G138500.1.p 652 LQGWKGHILYASTCW 666
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.505269650IPR005202Transcription factor GRAS
PfamPF035144.8E-103295666IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MESNFTGADD LFAEDKGMPY LSDSLGFATM DPSPEDNNDF LETANFISHI LTEENVEQRP  60
FYDSLTLNRN PSTMLSPATY LFHPFNTLSP EDETTTSSSN DSNNNFSDEN SRELRLPSPD  120
SLFVSAFQFN PNTLSQPPPS VTVSDGVSDL DSSIANLLAH NIFNHVDSVS QFRRGLEEAS  180
KFLPPGPNLV TDLDSYGEQI IKFFWREFLW VEGKNHEHEE IDTREEGRRS NKQSALSLVD  240
ETDLSDAFDR VLIHEGKQCD KHNCLQGGSV NVEERDRGKV RSKNQEGRKK ETVDLRNLLL  300
MCAQSVYAND SRTANELLKQ IRQHSSAIGD ASQRLVHYFA NGLKTCLIGD GTGAQGMYFF  360
LTSKKITAAE FLTTYLVFLS ASPFKKFIHF FANKMIMKAA AKAETVHVID FGILYGFQCP  420
SLIKFLSNRE SGPPKLRITG IEFPQPGFRP TERIEETGHC LANYCKHYNV PFEYNAIASK  480
NRESIQVEAL KIQSNELVAV NCHLRFENLL NESIEVNSPR NAVLHLIRKI NQDIFTQSIT  540
NGSYNAPFFA TRFREALFHY SATYELIDTV IPRENEWRLM IERELLGREI MNVIACEGSQ  600
RIERPETYKQ WQVRNTRAGF KKLPLNEELM AKLRTANGTT DFVLDEDNNW LLQGWKGHIL  660
YASTCWVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A7e-4430266826380Protein SCARECROW
5b3h_A6e-4430266825379Protein SCARECROW
5b3h_D6e-4430266825379Protein SCARECROW
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1278289KVRSKNQEGRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.217510.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G138500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539082.10.0scarecrow-like protein 14
RefseqXP_028191532.10.0scarecrow-like protein 14
TrEMBLA0A0R0HMZ50.0A0A0R0HMZ5_SOYBN; Uncharacterized protein
STRINGGLYMA11G14720.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-169SCARECROW-like 14