PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.11G138400.1.p
Common NameGLYMA_11G138400, LOC100795855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family GRAS
Protein Properties Length: 674aa    MW: 76594 Da    PI: 6.224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.11G138400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3864.2e-1182966701373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++lLl c + v ++d++ a++lL+++++++sp gd+ qRla+yft++L+arl++ +++     +  ++++ +++e l+a+++f   sP+
  Glyma.11G138400.1.p 296 LRNLLLMCSQSVYANDNRTANELLKQIRQHSSPVGDASQRLAHYFTNGLEARLVGDGTSAQGMYTFLSSKNITVAEFLKAYQVFTSSSPF 385
                          6899**************************************************9666666555666666566***************** PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                           kf h+ aN++I++a++++e+vHiiDf+i +G+QWp L++ +++R++gpp+lRiTg++ p++g   +e++eetg+rLa+++++ +vpfe+
  Glyma.11G138400.1.p 386 KKFIHFFANKMIMKAAAKAETVHIIDFGILYGFQWPILIKFFSNREGGPPKLRITGIEFPQPGfrPAERIEETGHRLANYCKRYNVPFEY 475
                          **************************************************************9*************************** PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n++++k++e++++e+L+++++E +aVn++l+ ++lldes +++s+r+ vL+l+++++P++++ +  + ++n++ F++rf eal +ysa++
  Glyma.11G138400.1.p 476 NAIASKNWENIQVEALKIQSNELVAVNCHLRFENLLDESIEVNSPRNGVLHLIRKINPDIFTQSITNGSYNAPFFATRFREALFHYSAIY 565
                          ***9************************************************************************************** PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          d +++ +pre+e+r ++Erellgrei+nv+aceg+er+er et+++W  r ++aGFk++pl+e+ +++ ++ l++ + + +  +e+++++
  Glyma.11G138400.1.p 566 DLIDTVIPRENEWRLMLERELLGREIMNVIACEGSERIERPETYKQWYVRNTRAGFKQLPLNEELMAKFRTKLKEWYHRDFVFDEDNKWM 655
                          *****************************************************************************999********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          ++gWk+r L++ ++W
  Glyma.11G138400.1.p 656 LQGWKGRILYASTCW 670
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.67270651IPR005202Transcription factor GRAS
PfamPF035141.4E-115296670IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MDSNFPGASE DQGTPYLSDS LGFATMEDND FSETAKFISQ ILMEENVDQK PFYDSLTLQV  60
TEKSFYDALA GNLPLSPDQH PVLLSPEAET TTTTTTSSSS SSSNNNFSDE YSRELKLRSP  120
DSISVSAFQF KSQPPPSVTV SDAVSDLDSS IAKLLAHNIF NHVDSVSQFR RGFEEASKFL  180
PPGPNLVTAL HSKREEPINS FGDNSYGLLK GRKNHQRQEI ETREEGEGER SNKQSALSLV  240
DESDLSDAFD RLLLHEGNLC DEHIRLTSGS VNVEERDGGK GRSKKQGRRK KETVDLRNLL  300
LMCSQSVYAN DNRTANELLK QIRQHSSPVG DASQRLAHYF TNGLEARLVG DGTSAQGMYT  360
FLSSKNITVA EFLKAYQVFT SSSPFKKFIH FFANKMIMKA AAKAETVHII DFGILYGFQW  420
PILIKFFSNR EGGPPKLRIT GIEFPQPGFR PAERIEETGH RLANYCKRYN VPFEYNAIAS  480
KNWENIQVEA LKIQSNELVA VNCHLRFENL LDESIEVNSP RNGVLHLIRK INPDIFTQSI  540
TNGSYNAPFF ATRFREALFH YSAIYDLIDT VIPRENEWRL MLERELLGRE IMNVIACEGS  600
ERIERPETYK QWYVRNTRAG FKQLPLNEEL MAKFRTKLKE WYHRDFVFDE DNKWMLQGWK  660
GRILYASTCW VPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5530367226380Protein SCARECROW
5b3h_A2e-5530367225379Protein SCARECROW
5b3h_D2e-5530367225379Protein SCARECROW
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1279290KGRSKKQGRRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.217510.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapGlyma.11G138400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539082.10.0scarecrow-like protein 14
RefseqXP_028191532.10.0scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A445I2K70.0A0A445I2K7_GLYSO; Scarecrow-like protein 14 isoform A
TrEMBLI1LK100.0I1LK10_SOYBN; Uncharacterized protein
STRINGGLYMA11G14720.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-174SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]