PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.10G191000.1.p | ||||||||
Common Name | GLYMA_10G191000, LOC100813935 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 267aa MW: 31280.1 Da PI: 8.6021 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.4 | 7.7e-19 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd ll+++vk +G g+W+++ar g++R +k+c++rw +yl Glyma.10G191000.1.p 23 KGPWTSEEDRLLIQYVKFHGEGRWNSVARLAGLKRNGKSCRLRWVNYL 70 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.2 | 1.2e-15 | 77 | 120 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g T++E+ ++ ++++++G++ W+tIar ++ gRt++++k++w+++ Glyma.10G191000.1.p 77 GHITPQEESIIQELHARWGNR-WSTIARSLP-GRTDNEIKNYWRTH 120 667******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 23.366 | 18 | 74 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.77E-30 | 20 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.4E-16 | 22 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.5E-17 | 23 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-23 | 24 | 76 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.17E-11 | 25 | 70 | No hit | No description |
PROSITE profile | PS51294 | 18.546 | 75 | 125 | IPR017930 | Myb domain |
SMART | SM00717 | 1.7E-14 | 75 | 123 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-13 | 76 | 120 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.3E-24 | 77 | 124 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.32E-9 | 80 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 267 aa Download sequence Send to blast |
MYWEVMAGNM GWSVIIEEEG WRKGPWTSEE DRLLIQYVKF HGEGRWNSVA RLAGLKRNGK 60 SCRLRWVNYL RPDLKKGHIT PQEESIIQEL HARWGNRWST IARSLPGRTD NEIKNYWRTH 120 FKKKTKTPSD AAEKARIRSS RRQQFQQQQQ QLKQQQVQQQ QQQQQQFQFN LDMKGIINLL 180 EENNHRVPSI SQEAQEMASM YPNTSEQQDY FYSMFNVNDN NVSAPECLNE EILWDGLWNL 240 DDVLCNFNAA SATSKASLHN LVAPFC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 3e-27 | 23 | 125 | 27 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in floral tissues. expressed in all four whorls of the flower, in the anther vascular tissue and in cells at the junction between anther and stamen filaments. Detected in the nectaries and ovules. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19325888, ECO:0000269|Ref.1}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:11967090, ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.10G191000.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT097047 | 0.0 | BT097047.1 Soybean clone JCVI-FLGm-15J22 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003536262.1 | 0.0 | myb-related protein 305 | ||||
Refseq | XP_028184030.1 | 0.0 | myb-related protein 305-like | ||||
Swissprot | Q9LK95 | 9e-53 | MYB21_ARATH; Transcription factor MYB21 | ||||
TrEMBL | A0A445IPN1 | 0.0 | A0A445IPN1_GLYSO; Transcription factor MYB2 | ||||
TrEMBL | I1LCF7 | 0.0 | I1LCF7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA10G33450.1 | 0.0 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1182 | 34 | 108 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24310.1 | 4e-80 | myb domain protein 305 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.10G191000.1.p |
Entrez Gene | 100813935 |
Publications ? help Back to Top | |||
---|---|---|---|
|