PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.10G117500.1.p | ||||||||
Common Name | GLYMA_10G117500 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 103aa MW: 12344.1 Da PI: 10.9605 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.5 | 1.2e-16 | 48 | 92 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g T++E+ +++++++++G++ W+tIar ++ +Rt++++k++w+++ Glyma.10G117500.1.p 48 KGQITPQEESIILELHARWGNR-WSTIARSLP-RRTDNEIKNYWRTH 92 5778******************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 5.819 | 5 | 42 | IPR017877 | Myb-like domain |
SMART | SM00717 | 33 | 12 | 44 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.9E-10 | 26 | 54 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.67E-20 | 26 | 98 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.625 | 43 | 97 | IPR017930 | Myb domain |
SMART | SM00717 | 3.3E-14 | 47 | 95 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-14 | 48 | 92 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.29E-9 | 52 | 93 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-19 | 55 | 93 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
MGWGVIEEEG WRKGPWTSEE DKLLILTKRN GKSCRLRWVN YLRSDHKKGQ ITPQEESIIL 60 ELHARWGNRW STIARSLPRR TDNEIKNYWR THFKKKIRAH FS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-19 | 13 | 97 | 7 | 108 | B-MYB |
1mse_C | 2e-19 | 13 | 97 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 2e-19 | 13 | 97 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.10G117500.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT097047 | 6e-91 | BT097047.1 Soybean clone JCVI-FLGm-15J22 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025980019.1 | 2e-65 | myb-related protein 305-like | ||||
Swissprot | Q9LX82 | 1e-36 | MYB48_ARATH; Transcription factor MYB48 | ||||
TrEMBL | K7LIT8 | 2e-68 | K7LIT8_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA10G22761.1 | 3e-69 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1182 | 34 | 108 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24310.1 | 1e-49 | myb domain protein 305 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.10G117500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|