PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.08G124200.2.p | ||||||||
Common Name | GLYMA_08G124200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 207aa MW: 23028.2 Da PI: 7.2918 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 105.2 | 5.5e-33 | 111 | 167 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k+ +++rkpylheSRhkhAlrRpRg+gGrF Glyma.08G124200.2.p 111 EEPVFVNAKQYHGILRRRQSRAKAESENKV-IRNRKPYLHESRHKHALRRPRGCGGRF 167 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.6E-37 | 109 | 170 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.788 | 110 | 170 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.0E-28 | 112 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.3E-24 | 113 | 135 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 115 | 135 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.3E-24 | 144 | 167 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 207 aa Download sequence Send to blast |
MTSAHDLTDN EDDGQQQSES QIQSPSANGI SDPDISTQNV NVQYATPGQL GTGHAMVPPV 60 YPYPDPYYRS IFAPYDTQPY PPQAYSGQPM VHLQLMGIQQ AGVPLPTDAV EEPVFVNAKQ 120 YHGILRRRQS RAKAESENKV IRNRKPYLHE SRHKHALRRP RGCGGRFLNS KKDENQHDDV 180 TSADKSQSNI NLNSNKNDQT SSDRTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 4e-22 | 110 | 177 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 151 | 160 | RHKHALRRPR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.22381 | 0.0 | flower| leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.08G124200.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT089415 | 0.0 | BT089415.1 Soybean clone JCVI-FLGm-1L22 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001235566.2 | 1e-152 | putative CCAAT-binding transcription factor | ||||
Refseq | XP_028243632.1 | 1e-152 | nuclear transcription factor Y subunit A-7-like | ||||
Swissprot | Q84JP1 | 3e-72 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A445JDN1 | 1e-150 | A0A445JDN1_GLYSO; Nuclear transcription factor Y subunit A-7 isoform B (Fragment) | ||||
TrEMBL | A0A445JDP0 | 1e-151 | A0A445JDP0_GLYSO; Nuclear transcription factor Y subunit A-7 isoform A | ||||
TrEMBL | I1KSM7 | 1e-151 | I1KSM7_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA08G13090.1 | 1e-152 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 4e-61 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.08G124200.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|