PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.08G011300.1.p | ||||||||
Common Name | GLYMA_08G011300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 148aa MW: 17141.3 Da PI: 10.2319 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 97 | 1.2e-30 | 67 | 125 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG K+vk+++fpr+YYrC+++gC+vkk+++r ++d+++v++tYeg H h+ Glyma.08G011300.1.p 67 LDDGYRWRKYGEKSVKNNKFPRNYYRCSYRGCNVKKQIQRHSKDEEIVVTTYEGIHIHP 125 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.5E-31 | 52 | 125 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.96E-27 | 59 | 126 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.759 | 62 | 127 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.3E-35 | 67 | 126 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.9E-25 | 68 | 125 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 148 aa Download sequence Send to blast |
MEKHQVLSPI SSSSSTSPSD FKLGDHNSNA HVKKAGLLKT QRPSLKGGKE IKQHRYAFQT 60 RSHVDILDDG YRWRKYGEKS VKNNKFPRNY YRCSYRGCNV KKQIQRHSKD EEIVVTTYEG 120 IHIHPVEKST ESFEQILRNH HIYSLTL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-25 | 57 | 124 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-25 | 57 | 124 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.36862 | 1e-99 | cotyledon| pod |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.08G011300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU019567 | 0.0 | EU019567.1 Glycine max WRKY25 (WRKY25) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001237010.2 | 1e-107 | WRKY transcription factor 25 | ||||
Refseq | XP_028247153.1 | 1e-107 | probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 7e-49 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A445J882 | 1e-105 | A0A445J882_GLYSO; Putative WRKY transcription factor 75 | ||||
TrEMBL | I1KP65 | 1e-105 | I1KP65_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA08G01430.1 | 1e-106 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 6e-51 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.08G011300.1.p |