PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.07G199000.1.p | ||||||||
Common Name | GLYMA_07G199000 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 147aa MW: 17020.7 Da PI: 7.5348 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 137.7 | 3.4e-43 | 65 | 140 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cqv++C+adlseak+yhrrhkvCe h+kap+v ++gl+qrfCqqCsrfhelsefD++krsCr+rLa+hnerrrk++ Glyma.07G199000.1.p 65 CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHELSEFDDSKRSCRTRLAGHNERRRKNA 140 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 2.2E-56 | 4 | 146 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 4.8E-37 | 57 | 126 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.342 | 62 | 139 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.47E-39 | 63 | 143 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 2.3E-34 | 65 | 138 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MDTSRYEGKR VLRYKEEDEN DDDEEEEEVS EVGFGADRRR NKRVMRDLHG KRSGSKGGGS 60 MPPSCQVDNC DADLSEAKQY HRRHKVCEYH AKAPSVHMAG LQQRFCQQCS RFHELSEFDD 120 SKRSCRTRLA GHNERRRKNA VDYHGE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-37 | 54 | 138 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.07G199000.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT096726 | 0.0 | BT096726.1 Soybean clone JCVI-FLGm-15P19 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025984849.1 | 1e-104 | uncharacterized protein LOC100789055 isoform X1 | ||||
Swissprot | Q38741 | 4e-48 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | I1KLM6 | 1e-103 | I1KLM6_SOYBN; Squamosa promoter-binding-like protein | ||||
STRING | GLYMA07G31880.1 | 1e-104 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF535 | 34 | 153 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 2e-41 | squamosa promoter binding protein-like 3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.07G199000.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|