![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.06G308900.2.p | ||||||||
Common Name | GLYMA_06G308900 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 189aa MW: 21127.1 Da PI: 8.2991 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 224.5 | 2.9e-69 | 6 | 162 | 5 | 170 |
YABBY 5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 ++e+vCyv+CnfCntilavsvP++sl+++vtvrCGhC++llsvn+ + q+ + ++ +s +++ l +ee + +e +s+s+ Glyma.06G308900.2.p 6 MATERVCYVHCNFCNTILAVSVPYSSLLTIVTVRCGHCANLLSVNMGASLQAFPPQDP--QS----QKQLLSFEEPSSC--KELGSSSSK 87 689**************************************************99996..22....2222333332222..222233333 PP YABBY 95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 ++ + e ++e pr+pp irP ekr rvPsaynrfikeeiqrikasnPdishreafs aaknWahfP+ihfgl Glyma.06G308900.2.p 88 CNKIAPFHEAVEHEQPRIPP-IRPTEKRHRVPSAYNRFIKEEIQRIKASNPDISHREAFSSAAKNWAHFPHIHFGL 162 333444568889999**999.9****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 4.7E-73 | 7 | 162 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.57E-7 | 107 | 155 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.1E-4 | 115 | 156 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MSMEMMATER VCYVHCNFCN TILAVSVPYS SLLTIVTVRC GHCANLLSVN MGASLQAFPP 60 QDPQSQKQLL SFEEPSSCKE LGSSSSKCNK IAPFHEAVEH EQPRIPPIRP TEKRHRVPSA 120 YNRFIKEEIQ RIKASNPDIS HREAFSSAAK NWAHFPHIHF GLKNLKLDGN KQEKLDQGEG 180 AEKSNGFY* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.56553 | 0.0 | leaf |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in subepidermal cells of anlagen regions, then in abaxial part of primordia and finally in differentiating organs. Levels decrease in differentiated organs. In embryo, expressed from the heart stage in the abaxial domain of the cotyledon primordia and decrease as the embryo matures. In stamen, expression restricted to the abaxial region differentiating into the connective. In gynoecium, expressed in the abaxial cell layers differentiating into the valves. {ECO:0000269|PubMed:10457020}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at low levels in abaxial regions of lateral aerial organ primordia leading to cotyledons, leaves, flower meristems, sepals, petals, stamen and carpels, but not in roots. {ECO:0000269|PubMed:10457020}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.06G308900.2.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT090571 | 0.0 | BT090571.1 Soybean clone JCVI-FLGm-4H4 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001344735.1 | 1e-140 | protein YABBY 9 isoform 2 | ||||
Refseq | XP_025984467.1 | 1e-140 | transcription factor YABBY9 isoform X4 | ||||
Swissprot | Q9XFB0 | 8e-77 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A445KG97 | 1e-138 | A0A445KG97_GLYSO; Putative axial regulator YABBY 2 isoform A | ||||
TrEMBL | I1KFH5 | 1e-138 | I1KFH5_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA12G10210.3 | 1e-124 | (Glycine max) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 3e-76 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.06G308900.2.p |
Publications ? help Back to Top | |||
---|---|---|---|
|