PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.03G091700.1.p | ||||||||
Common Name | GLYMA_03G091700 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 109aa MW: 12037.8 Da PI: 5.9122 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 148 | 2e-46 | 23 | 108 | 2 | 87 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 re drflPianvsrimkk+l anaki k aketvqecvsefisf+ +easdkcqrekrk ingddllwa++tlGfedyveplk yl Glyma.03G091700.1.p 23 RELDRFLPIANVSRIMKKALLANAKILKYAKETVQECVSEFISFIIDEASDKCQREKRKVINGDDLLWAMTTLGFEDYVEPLKGYL 108 789********************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.7E-42 | 21 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 7.3E-31 | 26 | 108 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.4E-23 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.0E-17 | 56 | 74 | No hit | No description |
PRINTS | PR00615 | 8.0E-17 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 8.0E-17 | 94 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 109 aa Download sequence Send to blast |
MADSDNDSGG AHNSGKGGKV LPRELDRFLP IANVSRIMKK ALLANAKILK YAKETVQECV 60 SEFISFIIDE ASDKCQREKR KVINGDDLLW AMTTLGFEDY VEPLKGYL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 9e-39 | 23 | 108 | 2 | 87 | Transcription factor HapC (Eurofung) |
4g92_B | 9e-39 | 23 | 108 | 2 | 87 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.29090 | 1e-126 | cotyledon |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.03G091700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT017830 | 3e-74 | BT017830.1 Zea mays clone EL01N0508H10.c mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006602134.1 | 2e-65 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_028214205.1 | 2e-65 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q75IZ7 | 3e-58 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0B2QR59 | 4e-74 | A0A0B2QR59_GLYSO; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | K7KDZ5 | 4e-74 | K7KDZ5_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA03G22721.1 | 7e-75 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-50 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.03G091700.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|