PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Glyma.02G109800.1.p | ||||||||
Common Name | GLYMA_02G109800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 280aa MW: 32055.4 Da PI: 9.2396 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 175.4 | 1.6e-54 | 9 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 lppGfrFhPtdeel+v+yL+++++++++++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+r++ky++g r+nrat sgyWkatg+dk Glyma.02G109800.1.p 9 LPPGFRFHPTDEELIVYYLCNQATSRPCPA-SIIPEVDIYKFDPWELPEKTDFGEKEWYFFSPRERKYPNGVRPNRATVSGYWKATGTDK 97 79****************************.89***************99999************************************* PP NAM 91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +++s ++++vg+kk Lvfykg+ pkg ktdW+mheyrl Glyma.02G109800.1.p 98 AIYS-GSKHVGVKKALVFYKGKPPKGLKTDWIMHEYRL 134 ****.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.49E-66 | 5 | 161 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.737 | 9 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-26 | 10 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009825 | Biological Process | multidimensional cell growth | ||||
GO:0009835 | Biological Process | fruit ripening | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 280 aa Download sequence Send to blast |
MENRTSSVLP PGFRFHPTDE ELIVYYLCNQ ATSRPCPASI IPEVDIYKFD PWELPEKTDF 60 GEKEWYFFSP RERKYPNGVR PNRATVSGYW KATGTDKAIY SGSKHVGVKK ALVFYKGKPP 120 KGLKTDWIMH EYRLIGSRRQ ANRQVGSMRL DDWVLCRIYK KKNIGKSMEA KEEYPIAQIN 180 LTPANNDSEQ EMVKFPRTSS LTHLLEMDYL GPISHILSDA TYNSTFDFQI NTANGGIDPF 240 VKPQPVEIPY AADSGKYQVK QNSTINPTIF VNQVYYQRG* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-72 | 5 | 163 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-72 | 5 | 163 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-72 | 5 | 163 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-72 | 5 | 163 | 13 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-72 | 5 | 163 | 16 | 170 | NAC domain-containing protein 19 |
4dul_A | 1e-72 | 5 | 163 | 13 | 167 | NAC domain-containing protein 19 |
4dul_B | 1e-72 | 5 | 163 | 13 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Gma.26628 | 0.0 | cotyledon| flower| hypocotyl| leaf| root| stem| vegetative bud |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00221 | DAP | Transfer from AT1G69490 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Glyma.02G109800.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU661923 | 0.0 | EU661923.1 Glycine max NAC domain protein (NAC26) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028202582.1 | 0.0 | NAC domain-containing protein 2-like | ||||
Swissprot | K4BNG7 | 1e-115 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | A0A0B2Q3A2 | 0.0 | A0A0B2Q3A2_GLYSO; NAC domain-containing protein 29 | ||||
TrEMBL | A0A0R4J2P4 | 0.0 | A0A0R4J2P4_SOYBN; Uncharacterized protein | ||||
STRING | GLYMA02G12220.1 | 0.0 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4103 | 32 | 62 | Representative plant | OGRP17 | 15 | 800 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-115 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | Glyma.02G109800.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|