PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_Sca145821G01
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 63aa    MW: 7294.48 Da    PI: 5.0201
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_Sca145821G01genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC116.81e-361633092
            NF-YC 30 lkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdfl 92
                     +kadedv+misaeaP+l++kacelfilelt+rswlhaeenkrrtl+k+diaaa+trtdifdfl
  Gh_Sca145821G01  1 MKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFL 63
                     9*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.65E-22163IPR009072Histone-fold
PfamPF008085.5E-15154IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.6E-27163IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MKADEDVRMI SAEAPILFAK ACELFILELT IRSWLHAEEN KRRTLQKNDI AAAITRTDIF  60
DFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B3e-361632789NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14147RRTLQKN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.98381e-104boll| ovule
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342}.
UniprotTISSUE SPECIFICITY: Ubiquitous. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:17322342, ECO:0000269|PubMed:9662544}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000250, ECO:0000269|PubMed:17322342}.
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284041.11e-39PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
RefseqXP_003602805.12e-39nuclear transcription factor Y subunit C-1 isoform X2
RefseqXP_004138046.12e-39PREDICTED: nuclear transcription factor Y subunit C-1-like
RefseqXP_008464428.12e-39PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_009149806.12e-39PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_010026475.11e-39PREDICTED: nuclear transcription factor Y subunit C-1
RefseqXP_010250693.11e-39PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2
RefseqXP_010663766.11e-39PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2
RefseqXP_013461673.12e-39nuclear transcription factor Y subunit C-1 isoform X1
RefseqXP_013727066.12e-39nuclear transcription factor Y subunit C-1
RefseqXP_016169923.22e-39LOW QUALITY PROTEIN: nuclear transcription factor Y subunit C-1
RefseqXP_022039073.12e-39nuclear transcription factor Y subunit C-1-like isoform X1
RefseqXP_022039075.11e-39nuclear transcription factor Y subunit C-1-like isoform X2
RefseqXP_022134838.12e-39nuclear transcription factor Y subunit C-1-like
RefseqXP_022885495.12e-39nuclear transcription factor Y subunit C-1
RefseqXP_022921750.12e-39nuclear transcription factor Y subunit C-1-like
RefseqXP_022987443.12e-39nuclear transcription factor Y subunit C-1
RefseqXP_023516854.12e-39nuclear transcription factor Y subunit C-1
RefseqXP_028765104.12e-39nuclear transcription factor Y subunit C-1-like isoform X2
RefseqXP_028766187.12e-39nuclear transcription factor Y subunit C-1-like
SwissprotQ9FMV53e-40NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
SwissprotQ9SMP02e-40NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A1U7ZPU63e-38A0A1U7ZPU6_NELNU; nuclear transcription factor Y subunit C-1-like isoform X2
TrEMBLA0A251US043e-38A0A251US04_HELAN; Putative histone-fold protein
TrEMBLA0A2U1M7062e-38A0A2U1M706_ARTAN; Nuclear transcription factor Y subunit C-1
TrEMBLA0A438EY753e-38A0A438EY75_VITVI; Nuclear transcription factor Y subunit C-1
TrEMBLA0A4D9AFA22e-38A0A4D9AFA2_SALSN; Uncharacterized protein
STRINGXP_006493208.18e-39(Citrus sinensis)
STRINGevm.model.supercontig_13.1072e-39(Carica papaya)
STRINGXP_008464428.16e-39(Cucumis melo)
STRINGXP_004138046.16e-39(Cucumis sativus)
STRINGBra018046.1-P6e-39(Brassica rapa)
STRINGGLYMA06G17780.18e-39(Glycine max)
STRINGAES730566e-39(Medicago truncatula)
STRINGXP_007137908.17e-39(Phaseolus vulgaris)
STRINGcassava4.1_015422m8e-39(Manihot esculenta)
STRINGcassava4.1_034343m8e-39(Manihot esculenta)
STRINGSolyc03g110860.2.18e-39(Solanum lycopersicum)
STRINGXP_009779358.18e-39(Nicotiana sylvestris)
STRINGXP_009618952.18e-39(Nicotiana tomentosiformis)
STRINGXP_009619035.18e-39(Nicotiana tomentosiformis)
STRINGPGSC0003DMT4000394708e-39(Solanum tuberosum)
STRINGMigut.I00537.1.p8e-39(Erythranthe guttata)
STRINGXP_008798937.17e-39(Phoenix dactylifera)
STRINGA0A087GWB68e-39(Arabis alpina)
STRINGXP_010026475.15e-39(Eucalyptus grandis)
STRINGXP_006436849.18e-39(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47828160
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48590.19e-43nuclear factor Y, subunit C1
Publications ? help Back to Top
  1. Shi H,Chan ZL
    AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway.
    Plant Signal Behav, 2015.
    [PMID:24831307]
  2. Shi H,Chan ZL
    AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway.
    Plant Signal Behav, 2014. 9(7): p. e29109
    [PMID:25763489]
  3. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  4. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  5. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  6. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  7. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  8. Qi M, et al.
    QQS orphan gene and its interactor NF-YC4 reduce susceptibility to pathogens and pests.
    Plant Biotechnol. J., 2019. 17(1): p. 252-263
    [PMID:29878511]