PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_Sca138215G01 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 103aa MW: 11462 Da PI: 8.2151 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 76.5 | 4.9e-24 | 1 | 64 | 36 | 99 |
DUF260 36 lFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 +FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++ Gh_Sca138215G01 1 IFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAITFLQRQVQRLQKELDAANA 64 7**********************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 15.69 | 1 | 66 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.0E-22 | 1 | 63 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
IFGASNVTKL LNELLPHQRE DAVNSLAYEA EARVRDPVYG CVGAITFLQR QVQRLQKELD 60 AANADLIRYA CNDIPTGLPQ VTGTSSVQPP LTPRNRLAEF NRR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-42 | 1 | 82 | 46 | 130 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-42 | 1 | 82 | 46 | 130 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016748663.1 | 1e-69 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_016748664.1 | 1e-69 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_017605768.1 | 2e-69 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 1e-41 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | A0A1U8PEF1 | 3e-68 | A0A1U8PEF1_GOSHI; protein LATERAL ORGAN BOUNDARIES-like | ||||
TrEMBL | A0A2P5WNI8 | 4e-68 | A0A2P5WNI8_GOSBA; Uncharacterized protein | ||||
STRING | EOY20851 | 7e-59 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 6e-44 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|