PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_Sca133064G01 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 71aa MW: 8458.8 Da PI: 10.6477 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.9 | 4.7e-10 | 30 | 71 | 2 | 43 |
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterq 43 +k+++f++eq++ Le+ Fe++ ++ +++ +LA+klgL+ rq Gh_Sca133064G01 30 KKKRRFSDEQIRLLESIFESETKLEPRKKMQLARKLGLQPRQ 71 56779**********************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.8E-11 | 17 | 71 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.67E-9 | 19 | 71 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 9.912 | 26 | 71 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 1.8E-7 | 30 | 71 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.60E-5 | 35 | 71 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 71 aa Download sequence Send to blast |
METEYHPAVD EAIAEQAPQI PRNKKNNKLK KKRRFSDEQI RLLESIFESE TKLEPRKKMQ 60 LARKLGLQPR Q |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 29 | 33 | KKKRR |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016695089.1 | 2e-43 | PREDICTED: homeobox-leucine zipper protein ATHB-12-like | ||||
Swissprot | P46897 | 8e-16 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
TrEMBL | A0A1U8K3A9 | 5e-42 | A0A1U8K3A9_GOSHI; homeobox-leucine zipper protein ATHB-12-like | ||||
STRING | Gorai.004G123100.1 | 4e-31 | (Gossypium raimondii) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46680.2 | 3e-15 | homeobox 7 |
Publications ? help Back to Top | |||
---|---|---|---|
|