PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca129122G01

Common Name

SPL17

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

SBP

Protein Properties

Length: 85aa MW: 9282.42 Da PI: 9.0717

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca129122G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	75.8	6.8e-24	38	85	1	48
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 +Cqve+C adl++ak+yhrrhkvCe+hska+++lv +++qrfCqqCsr Gh_Sca129122G01 38 VCQVEDCGADLTNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSR 85 6**********************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	5.0E-25	31	85	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	19.991	36	85	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.22E-22	37	85	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	2.3E-17	39	85	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
LGGQGDHGYP ISQGEMKNWE GTSGKKTKLN GGSGNRAVCQ VEDCGADLTN AKDYHRRHKV 60 CEMHSKASKA LVGNVMQRFC QQCSR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	1e-23	34	85	1	52	squamosa promoter-binding protein-like 12
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed during plant development. {ECO:0000269\|PubMed:10524240}.

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269\|PubMed:16554053}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KJ622325	1e-141	KJ622325.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL17) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017630761.1	1e-53	PREDICTED: squamosa promoter-binding-like protein 1
Swissprot	Q9S7P5	8e-28	SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBL	A0A0B0MYY2	2e-52	A0A0B0MYY2_GOSAR; Squamosa promoter-binding-like protein 1
TrEMBL	A0A2P5XYX4	3e-52	A0A2P5XYX4_GOSBA; Uncharacterized protein
STRING	Gorai.007G116100.1	7e-53	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM868	28	118

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G60030.1	3e-30	squamosa promoter-binding protein-like 12

Publications ? help Back to Top
Jung S, et al. Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes. BMC Genomics, 2006. 7: p. 81 [PMID:16615871] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Zhang X, et al. Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum. Mol. Genet. Genomics, 2015. 290(1): p. 115-26 [PMID:25159110] Chao LM, et al. Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage. Mol Plant, 2017. 10(5): p. 735-748 [PMID:28400323]