PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca118136G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

LBD

Protein Properties

Length: 90aa MW: 9922.43 Da PI: 7.7735

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca118136G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	127.7	5.4e-40	10	89	1	80
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 +CaaCk lrrkC +dC++apyfp e+p+kf nvhk+FGasnv+kll+++p+++reda++sl+yeAear++dPvyG+vg i Gh_Sca118136G01 10 PCAACKCLRRKCMPDCIFAPYFPPEEPQKFINVHKIFGASNVSKLLNDVPPHQREDAVNSLAYEAEARMKDPVYGCVGAI 89 7*****************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	25.643	9	90	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	2.2E-39	10	89	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MASSSYSNPP CAACKCLRRK CMPDCIFAPY FPPEEPQKFI NVHKIFGASN VSKLLNDVPP 60 HQREDAVNSL AYEAEARMKD PVYGCVGAIS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	8e-50	3	90	4	91	LOB family transfactor Ramosa2.1
5ly0_B	8e-50	3	90	4	91	LOB family transfactor Ramosa2.1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269\|PubMed:12068116}.
Uniprot	TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269\|PubMed:12068116}.

Functional Description ? help Back to Top
Source	Description
UniProt	Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269\|PubMed:11934861}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012458035.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_012458036.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_012458037.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_016679016.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_016679017.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_017614825.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Refseq	XP_017614826.1	2e-61	PREDICTED: LOB domain-containing protein 25-like
Swissprot	Q8L8Q3	2e-50	LBD25_ARATH; LOB domain-containing protein 25
Swissprot	Q9FML4	2e-50	LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBL	A0A0D2RYJ3	4e-60	A0A0D2RYJ3_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8ILK5	4e-60	A0A1U8ILK5_GOSHI; LOB domain-containing protein 25-like
TrEMBL	A0A2P5XNB6	4e-60	A0A2P5XNB6_GOSBA; Uncharacterized protein
STRING	Gorai.012G063800.1	7e-61	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM131	28	340

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27650.1	7e-53	LOB domain-containing protein 25

Publications ? help Back to Top
Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310] Xu C, et al. Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751] Liu J, et al. The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture. Plant Cell Physiol., 2018. 59(4): p. 734-743 [PMID:29361138]