PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca088565G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB_related

Protein Properties

Length: 85aa MW: 9544.75 Da PI: 4.106

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca088565G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.3	1.8e-13	38	80	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g+WT +E +ll++a +++ + W+ Ia+++ ++t qc++++++ Gh_Sca088565G01 38 GKWTDQETLLLLEALELYKEN-WNEIAEHVA-TKTKAQCILHFLQ 80 89***************88.*****.********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.3E-10	34	78	IPR009057	Homeodomain-like
PROSITE profile	PS51293	23.007	35	85	IPR017884	SANT domain
SuperFamily	SSF46689	6.36E-14	35	84	IPR009057	Homeodomain-like
SMART	SM00717	1.5E-12	36	84	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-13	38	81	IPR001005	SANT/Myb domain
CDD	cd00167	3.12E-5	56	81	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
ADFDLCTDCF NNRKFGSGMS SSDFILMEPG EASGLSGGKW TDQETLLLLE ALELYKENWN 60 EIAEHVATKT KAQCILHFLQ MPIED

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2yus_A	2e-11	18	85	1	66	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily C member 1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269\|PubMed:14682613}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of a multiprotein complex equivalent of the SWI/SNF complex, an ATP-dependent chromatin-remodeling complex, which is required for the positive and negative regulation of gene expression of a large number of genes. It changes chromatin structure by altering DNA-histone contacts within a nucleosome, leading eventually to a change in nucleosome position, thus facilitating or repressing binding of gene-specific transcription factors.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012480315.1	5e-55	PREDICTED: SWI/SNF complex subunit SWI3D-like
Refseq	XP_016691525.1	5e-55	PREDICTED: SWI/SNF complex subunit SWI3D-like
Refseq	XP_016714567.1	6e-55	PREDICTED: SWI/SNF complex subunit SWI3D-like
Refseq	XP_016714569.1	6e-55	PREDICTED: SWI/SNF complex subunit SWI3D-like
Swissprot	Q8VY05	4e-32	SWI3D_ARATH; SWI/SNF complex subunit SWI3D
TrEMBL	A0A0D2RKZ3	1e-53	A0A0D2RKZ3_GOSRA; Uncharacterized protein
TrEMBL	A0A1U8JML7	1e-53	A0A1U8JML7_GOSHI; SWI/SNF complex subunit SWI3D-like
TrEMBL	A0A1U8LN08	1e-53	A0A1U8LN08_GOSHI; SWI/SNF complex subunit SWI3D-like
TrEMBL	A0A2P5QKG5	1e-53	A0A2P5QKG5_GOSBA; Uncharacterized protein
STRING	Gorai.005G242600.1	2e-54	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM35282	2	2

Publications ? help Back to Top
Sarnowski TJ,Swiezewski S,Pawlikowska K,Kaczanowski S,Jerzmanowski A AtSWI3B, an Arabidopsis homolog of SWI3, a core subunit of yeast Swi/Snf chromatin remodeling complex, interacts with FCA, a regulator of flowering time. Nucleic Acids Res., 2002. 30(15): p. 3412-21 [PMID:12140326] Zhou C,Miki B,Wu K CHB2, a member of the SWI3 gene family, is a global regulator in Arabidopsis. Plant Mol. Biol., 2003. 52(6): p. 1125-34 [PMID:14682613] Sarnowski TJ, et al. SWI3 subunits of putative SWI/SNF chromatin-remodeling complexes play distinct roles during Arabidopsis development. Plant Cell, 2005. 17(9): p. 2454-72 [PMID:16055636] Liu ZW, et al. The SET domain proteins SUVH2 and SUVH9 are required for Pol V occupancy at RNA-directed DNA methylation loci. PLoS Genet., 2014. 10(1): p. e1003948 [PMID:24465213] Liu ZW, et al. Two Components of the RNA-Directed DNA Methylation Pathway Associate with MORC6 and Silence Loci Targeted by MORC6 in Arabidopsis. PLoS Genet., 2016. 12(5): p. e1006026 [PMID:27171427]