PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Gh_Sca069014G01

Organism

Gossypium hirsutum

Taxonomic ID

3635

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB_related

Protein Properties

Length: 144aa MW: 16549.6 Da PI: 9.7897

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Gh_Sca069014G01	genome	NAU-NBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	46.8	6.7e-15	79	123	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ +++ + k++G+g+W+ I+r + +Rt+ q+ s+ qky Gh_Sca069014G01 79 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVMTRTPTQVASHAQKY 123 8***************************99**********9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51293	7.631	1	22	IPR017884	SANT domain
PROSITE profile	PS51294	21.447	72	128	IPR017930	Myb domain
SuperFamily	SSF46689	1.57E-17	74	127	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.9E-18	75	127	IPR006447	Myb domain, plants
SMART	SM00717	3.8E-13	76	126	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.7E-13	76	123	IPR009057	Homeodomain-like
CDD	cd00167	1.53E-11	79	124	No hit	No description
Pfam	PF00249	5.4E-13	79	123	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 144 aa Download sequence Send to blast
MVPGKTVEDV IKQYRELEED VSDIEAGLIP IPGYTTDSFR LEWVNDSQGF DGIRNYYTPG 60 GKRGSGSRPS DHERKKGVPW TEEEHRQFLM GLKKYGKGDW RNISRNFVMT RTPTQVASHA 120 QKYFIRQLTG GKDKKRTSIH DITT

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ghi.761	0.0	boll

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269\|PubMed:11937495}.

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269\|PubMed:11937495, ECO:0000269\|PubMed:9118809}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JN127772	8e-76	JN127772.1 Theobroma cacao clone TCC_BC076K20, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012435251.1	1e-103	PREDICTED: transcription factor DIVARICATA-like
Refseq	XP_016679905.1	1e-103	PREDICTED: transcription factor DIVARICATA-like isoform X2
Swissprot	Q8S9H7	8e-74	DIV_ANTMA; Transcription factor DIVARICATA
TrEMBL	A0A0D2R5P7	1e-102	A0A0D2R5P7_GOSRA; Uncharacterized protein
TrEMBL	A0A0D2SX26	1e-103	A0A0D2SX26_GOSRA; Uncharacterized protein
STRING	Gorai.007G378300.1	1e-103	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1228	27	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G38090.1	8e-74	MYB family protein

Publications ? help Back to Top
Galego L,Almeida J Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers. Genes Dev., 2002. 16(7): p. 880-91 [PMID:11937495] Almeida J,Rocheta M,Galego L Genetic control of flower shape in Antirrhinum majus. Development, 1997. 124(7): p. 1387-92 [PMID:9118809]