PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D13G1028 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 162aa MW: 18282.2 Da PI: 10.1373 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.2 | 9.4e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd llv +v+++G+g+W++++ g+ R+ k+c++rw +yl Gh_D13G1028 14 KGPWTPEEDILLVSYVQEHGPGNWRLVPTNTGLQRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 47.5 | 4e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E+ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l Gh_D13G1028 67 RGNFTPHEEGMIIHLQALLGNK-WAAIASYLP-QRTDNDVKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.1E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.424 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.79E-32 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.6E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.10E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.7E-25 | 65 | 117 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.652 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 3.2E-13 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-13 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.93E-10 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MGRSPCCDKV GIKKGPWTPE EDILLVSYVQ EHGPGNWRLV PTNTGLQRCS KSCRLRWTNY 60 LRPGIKRGNF TPHEEGMIIH LQALLGNKWA AIASYLPQRT DNDVKNYWNT HLKKKLKKFQ 120 PAMELPQMAQ ACLNKTLATG SSSTIATYAS STEIFLVFFK VG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 5e-26 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016704512.1 | 1e-120 | PREDICTED: myb-related protein 306-like | ||||
Swissprot | B3VTV7 | 1e-86 | MYB60_VITVI; Transcription factor MYB60 | ||||
TrEMBL | A0A1U8KPW7 | 1e-119 | A0A1U8KPW7_GOSHI; myb-related protein 306-like | ||||
STRING | Gorai.013G113000.1 | 1e-112 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08810.1 | 2e-83 | myb domain protein 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|