PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D12G1630 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 192aa MW: 21757.2 Da PI: 10.9596 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.1 | 1.5e-16 | 20 | 67 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd+ll +++++G g+W + +++ g+ R++k+c++rw +yl Gh_D12G1630 20 RGPWTAEEDKLLTAYIQKHGYGSWGSLPHKAGLERCGKSCRLRWINYL 67 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 56.7 | 5.5e-18 | 73 | 118 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++ eE++ ++++++ lG++ W++Ia++++ +Rt++++k++w+++l Gh_D12G1630 73 RGKFSLEEEQTIIQLHAFLGNR-WSAIAAHLP-KRTDNEIKNHWNTHL 118 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.079 | 15 | 67 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.35E-31 | 17 | 114 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.1E-12 | 19 | 69 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-15 | 20 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.1E-23 | 21 | 74 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.05E-10 | 22 | 67 | No hit | No description |
PROSITE profile | PS51294 | 24.716 | 68 | 122 | IPR017930 | Myb domain |
SMART | SM00717 | 5.5E-17 | 72 | 120 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-17 | 73 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.17E-12 | 75 | 118 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.8E-26 | 75 | 123 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 192 aa Download sequence Send to blast |
MLSKMRPPSP NRKKEVRLKR GPWTAEEDKL LTAYIQKHGY GSWGSLPHKA GLERCGKSCR 60 LRWINYLRPY IKRGKFSLEE EQTIIQLHAF LGNRWSAIAA HLPKRTDNEI KNHWNTHLKK 120 RLIKMGIDPM THKPSTSPSP KNGSNLSHMT QWESARLQAE ARLSQILPPA PLGGVNSPEA 180 VPGALTYSKP GK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 8e-27 | 18 | 122 | 25 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.10360 | 8e-71 | boll| ovule |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 13346187 | 8e-71 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in trichomes, stems, carpels, petals and stamens. {ECO:0000269|PubMed:18805951}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF336283 | 6e-68 | AF336283.1 Gossypium hirsutum GHMYB25 (ghmyb25) mRNA, complete cds. | |||
GenBank | EU826465 | 6e-68 | EU826465.1 Gossypium hirsutum cultivar Acala Maxxa R2R3 MYB transcription factor gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012438546.1 | 1e-116 | PREDICTED: transcription repressor MYB6-like isoform X1 | ||||
Refseq | XP_012438547.1 | 1e-116 | PREDICTED: transcription repressor MYB6-like isoform X2 | ||||
Swissprot | Q9LE63 | 3e-79 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | A0A0D2U576 | 1e-114 | A0A0D2U576_GOSRA; Uncharacterized protein | ||||
STRING | Gorai.008G179800.1 | 1e-115 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01140.1 | 3e-81 | myb domain protein 106 |