PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 658aa    MW: 73709.3 Da    PI: 6.829
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1134genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.18e-24123223198
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++++g +++ +k+a+e+     +++ + +++lt +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++el+
  Gh_D12G1134 123 FCKILTASDTSTHGGFSVLRKHATEClppldMNQATPTQELTAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGDNGELR 218
                  99****************************9555556679************************************************..3489999* PP

                  EEEE- CS
           B3  94 vkvfr 98 
                  v+v+r
  Gh_D12G1134 219 VGVRR 223
                  ***98 PP

2Auxin_resp102.17.4e-34249328183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  aaha+ t++ F v+Y+Pr+  s F++ v+k+++a++++ svGmRfkm+fe+eds+err++Gt+vgv d++p +W++SkWrsLk
  Gh_D12G1134 249 AAHAVMTQTLFVVYYKPRT--SHFIIGVSKYLEAINNRSSVGMRFKMRFEGEDSPERRFTGTIVGVGDASP-HWSESKWRSLK 328
                  79****************6..99*********************************************999.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-39113252IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.5E-40116238IPR015300DNA-binding pseudobarrel domain
CDDcd100177.17E-21121223No hitNo description
PfamPF023627.6E-22123223IPR003340B3 DNA binding domain
PROSITE profilePS5086312.111123225IPR003340B3 DNA binding domain
SMARTSM010191.1E-22123225IPR003340B3 DNA binding domain
PfamPF065072.5E-31249328IPR010525Auxin response factor
PfamPF023091.3E-11523623IPR033389AUX/IAA domain
SuperFamilySSF542779.81E-12540619No hitNo description
PROSITE profilePS5174525.901543635IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MAQPEGIPRE TGLGVDDLYP ELWKLCAGPL VEIPHVQERV FYFPQGHIEQ LEASTNQELN  60
YEAPLFNLSS KILCRVLHVQ LLAEQETDEV YAQITLQPEP DQSELTSPDP FPTEVPEREV  120
HSFCKILTAS DTSTHGGFSV LRKHATECLP PLDMNQATPT QELTAKDLHG YEWRFKHIFR  180
GQPRRHLLTT GWSTFVTSKR LVAGDAFVFL RGDNGELRVG VRRLGNQQST MPSSVISSQN  240
MHLGVLATAA HAVMTQTLFV VYYKPRTSHF IIGVSKYLEA INNRSSVGMR FKMRFEGEDS  300
PERRFTGTIV GVGDASPHWS ESKWRSLKIQ WDEPAMIQRP ERVSPWEIEP FSASASINLI  360
QPAVKSKRPR PVYIPASETT TNSTGSAFWC HGSTKSHELA RAGSIAEVQS SESSQVVWPM  420
RQNEADNTRA RLENAWPPSS LVNVSLNFFR NPADASPVEL RTSNDVMRDQ VEKGKKLEIS  480
TGCRLFGFNL TNSNSAVSGT VIAPSHIDEN PETFQSPKQQ KQNASETSTK EIKAKHGTTS  540
SMRTRTKVQM QGIAVGRAID LTVLKGYDDL INELEKMFDI EGELRHRTKW SVVFTDNEGD  600
MMLVGDDPWV GFCKMVRKIF IYSVDEVKKI NARCKFQASS LEGEGTVVSL GLEHRSGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1651235313357Auxin response factor 1
4ldw_A1e-1651235313357Auxin response factor 1
4ldw_B1e-1651235313357Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366370KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.221011e-72boll
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5778031e-87JX577803.1 Gossypium hirsutum clone NBRI_GE9702 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437774.10.0PREDICTED: auxin response factor 18-like isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2U2490.0A0A0D2U249_GOSRA; Auxin response factor
STRINGGorai.008G126200.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]