PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D11G2246 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 155aa MW: 18241.6 Da PI: 10.0174 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.6 | 1.1e-32 | 77 | 135 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+ Gh_D11G2246 77 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 135 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.5E-34 | 62 | 135 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.1E-29 | 69 | 136 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.344 | 72 | 137 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.8E-37 | 77 | 136 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-25 | 78 | 134 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 155 aa Download sequence Send to blast |
HREHLASDFG GPRLLSLQRS SANFWAWGEL NECLGSKKNG VDDHLGVSAM KMKRIKARRK 60 VREPRFCFKT MSEVDVLDDG YKWRKYGQKV VKNTQHPRSY YRCTQDNCRV KKRVERLAED 120 PRMVITTYEG RHVHSPSHDL DDSQPTDSQL NNFFW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 7e-28 | 68 | 134 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 7e-28 | 68 | 134 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.16854 | 0.0 | boll |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF669843 | 0.0 | KF669843.1 Gossypium hirsutum WRKY transcription factor 116 (WRKY116) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012492319.1 | 1e-114 | PREDICTED: probable WRKY transcription factor 13 | ||||
Swissprot | Q9SVB7 | 5e-61 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
TrEMBL | A0A1U8L018 | 1e-113 | A0A1U8L018_GOSHI; probable WRKY transcription factor 13 | ||||
STRING | Gorai.007G246500.1 | 1e-113 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6106 | 27 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39410.1 | 6e-54 | WRKY DNA-binding protein 13 |