PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D10G2614 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 195aa MW: 22300.2 Da PI: 8.587 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.8 | 2.5e-08 | 12 | 43 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+W++eEd++l+ ++k++G +W+ a+ g Gh_D10G2614 12 KGAWSPEEDKKLIAYIKRYGIWNWAEMAKPAG 43 79******************99****999777 PP | |||||||
2 | Myb_DNA-binding | 59.6 | 6.9e-19 | 91 | 134 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 g++T+eE+e ++d++++lG++ W+ Ia++++ gRt++++k++w+ + Gh_D10G2614 91 GNFTKEEEETIIDLHEKLGNR-WSVIASKLP-GRTDNEIKNHWHAH 134 89*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50090 | 9.918 | 7 | 84 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 8.73E-27 | 10 | 131 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.6E-7 | 11 | 86 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-6 | 12 | 45 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-22 | 13 | 91 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.21E-6 | 14 | 84 | No hit | No description |
PROSITE profile | PS51294 | 26.706 | 85 | 139 | IPR017930 | Myb domain |
SMART | SM00717 | 3.5E-17 | 89 | 137 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-16 | 91 | 134 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.68E-12 | 92 | 135 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.7E-26 | 92 | 140 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MAKSVENRAL KKGAWSPEED KKLIAYIKRY GIWNWAEMAK PAGKKNPEID CLYYDFCWVF 60 YGFCLFVGLQ RSGKSCRLRW VNYLRPGIKH GNFTKEEEET IIDLHEKLGN RWSVIASKLP 120 GRTDNEIKNH WHAHLSKRLK YDLNSLPDMS DAEIDQYSSF ETDPPPTNVP NALISESSAA 180 TSTNSLPSSS SNPKQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-24 | 3 | 139 | 18 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Fades out in old roots and leaves. {ECO:0000269|PubMed:24415840}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in imbibed seeds, hypocotyls, cotyledons, roots, seedlings, siliques and flowers. {ECO:0000269|PubMed:24415840}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that regulates freezing tolerance by affecting expression of CBF genes. {ECO:0000269|PubMed:24415840}. | |||||
UniProt | Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|PubMed:22246661}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cold stress. {ECO:0000269|PubMed:14675437, ECO:0000269|PubMed:20807373, ECO:0000269|Ref.2}. | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA), jasmonic acid (JA), salt (NaCl), ethylene and auxin (IAA) (PubMed:16463103). Down-regulated by cold treatment (PubMed:24415840). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:24415840}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ459183 | 6e-68 | AJ459183.1 Gossypium hirsutum partial myb153 gene, clone pGhMYB153. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016711418.1 | 1e-114 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_016711419.1 | 1e-114 | PREDICTED: myb-related protein Myb4-like | ||||
Refseq | XP_017648231.1 | 1e-114 | PREDICTED: myb-related protein Myb4-like | ||||
Swissprot | Q7XBH4 | 3e-45 | MYB4_ORYSJ; Transcription factor MYB4 | ||||
Swissprot | Q9SJX8 | 2e-45 | MYB14_ARATH; Transcription factor MYB14 | ||||
TrEMBL | A0A0B0P510 | 1e-113 | A0A0B0P510_GOSAR; Myb-related Myb4 | ||||
TrEMBL | A0A1U8LE21 | 1e-113 | A0A1U8LE21_GOSHI; myb-related protein Myb4-like | ||||
TrEMBL | A0A2P5WSG1 | 1e-113 | A0A2P5WSG1_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.011G021300.1 | 1e-105 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G31180.1 | 2e-47 | myb domain protein 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|