PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D09G1690 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 238aa MW: 27562.2 Da PI: 7.7522 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.2 | 1.2e-15 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++lv+ + +G +W+++++ g++R++k+c++rw +yl Gh_D09G1690 25 KGPWTAEEDKKLVNFMRTHGYYCWRAVPKLAGLRRCGKSCRLRWTNYL 72 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.2 | 2.5e-15 | 83 | 122 | 6 | 47 |
HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +E++l +d++++lG++ W+ Ia++++ gRt++++k++w+++ Gh_D09G1690 83 HDEEQLVIDLHARLGNR-WSQIAARLP-GRTDNEIKNYWNTH 122 68***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 6.8E-22 | 16 | 73 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 15.301 | 20 | 72 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.18E-27 | 22 | 119 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.0E-12 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.2E-14 | 25 | 72 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.42E-9 | 27 | 72 | No hit | No description |
PROSITE profile | PS51294 | 25.154 | 73 | 127 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-24 | 74 | 128 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-13 | 77 | 125 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-13 | 83 | 122 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.25E-9 | 84 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MVGVDWCKVR GMGRQPCCDK LGVKKGPWTA EEDKKLVNFM RTHGYYCWRA VPKLAGLRRC 60 GKSCRLRWTN YLRPDLKRGL LNHDEEQLVI DLHARLGNRW SQIAARLPGR TDNEIKNYWN 120 THIKKKLIKM GIDPVTHEPL QKPDTPQNKP NLDPNQPENL SKSCAHEFSL PTGPDEWRSS 180 WESDDDPSIN LIWPEAFLRD LSENFHGTDS WWKEYSEIGT SSKEETCFSW LVGDAGEQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-27 | 25 | 127 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.18523 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF651783 | 0.0 | EF651783.1 Gossypium hirsutum transcription factor TF1 (TF1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016670881.1 | 1e-178 | PREDICTED: protein ODORANT1-like | ||||
Swissprot | Q50EX6 | 3e-82 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | A0A1U8HXZ5 | 1e-177 | A0A1U8HXZ5_GOSHI; protein ODORANT1-like | ||||
STRING | Gorai.006G195700.1 | 1e-175 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G22680.1 | 5e-85 | myb domain protein 85 |
Publications ? help Back to Top | |||
---|---|---|---|
|