PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D09G0376 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 158aa MW: 18516.8 Da PI: 9.5468 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 105.5 | 2.8e-33 | 79 | 137 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d++vv++tYeg H+h+ Gh_D09G0376 79 LDDGYHWRKYGQKAVKDNKFPRSYYRCTHQGCNVKKQVQRLTKDESVVVTTYEGMHTHP 137 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.6E-33 | 64 | 137 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.12E-29 | 72 | 138 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.149 | 74 | 139 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.3E-39 | 79 | 138 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.0E-27 | 80 | 137 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MAPNSCQAFN SFHGDSSNGL LLDWKSSSSR NAENCFIQKP EVEETDNQMM KPSSVGKQKE 60 KKIRKQRYAF ETRSQVDVLD DGYHWRKYGQ KAVKDNKFPR SYYRCTHQGC NVKKQVQRLT 120 KDESVVVTTY EGMHTHPIHK PTDNFEHILN QMHIYKPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 69 | 138 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 69 | 138 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.23261 | 5e-38 | boll |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ640573 | 3e-94 | JQ640573.1 Gossypium barbadense WRKY transcription factor (WRKY1) mRNA, complete cds. | |||
GenBank | KF031099 | 3e-94 | KF031099.1 Gossypium hirsutum WRKY transcription factor 60 (WRKY60) mRNA, complete cds. | |||
GenBank | KF669759 | 3e-94 | KF669759.1 Gossypium hirsutum WRKY transcription factor 2 (WRKY2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016673489.1 | 1e-119 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-53 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A1U8ICH8 | 1e-117 | A0A1U8ICH8_GOSHI; probable WRKY transcription factor 75 | ||||
STRING | Gorai.006G043200.1 | 1e-116 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 7e-56 | WRKY DNA-binding protein 75 |