PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D09G0041 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 202aa MW: 22849.3 Da PI: 7.5546 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 178.6 | 5.7e-56 | 33 | 128 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfe+yv plk+yl+kyre+egek Gh_D09G0041 33 KEQDRFLPIANVGRIMKKVIPSNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEEYVGPLKLYLTKYREIEGEK 128 89*******************************************************************************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.9E-53 | 28 | 150 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.97E-40 | 35 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.2E-28 | 38 | 102 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.5E-19 | 66 | 84 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 69 | 85 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.5E-19 | 85 | 103 | No hit | No description |
PRINTS | PR00615 | 4.5E-19 | 104 | 122 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MEDENAAHGH NKGSPESPCA KSGGSSNNNN NNKEQDRFLP IANVGRIMKK VIPSNGKISK 60 DAKETVQECV SEFISFVTGE ASDKCQREKR KTINGDDIIW AITTLGFEEY VGPLKLYLTK 120 YREIEGEKLN LPKQQRSEQK QHQQSKHEQN IAFNTNVYSS TNLLSRHTSF VPSDQPFSLP 180 FSSNNIQKQL QQQDQIDSVG YW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-44 | 33 | 123 | 3 | 93 | NF-YB |
4awl_B | 1e-44 | 33 | 123 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-44 | 33 | 123 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 1e-44 | 33 | 123 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-44 | 33 | 123 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012483393.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit B-7 | ||||
Refseq | XP_016718692.1 | 1e-150 | PREDICTED: nuclear transcription factor Y subunit B-7-like | ||||
Swissprot | Q9SIT9 | 7e-70 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
TrEMBL | A0A0D2RMZ8 | 1e-149 | A0A0D2RMZ8_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8LVZ7 | 1e-149 | A0A1U8LVZ7_GOSHI; nuclear transcription factor Y subunit B-7-like | ||||
STRING | Gorai.006G005400.1 | 1e-150 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G13570.1 | 1e-65 | nuclear factor Y, subunit B7 |
Publications ? help Back to Top | |||
---|---|---|---|
|