PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D08G2181 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 290aa MW: 33175.2 Da PI: 5.9292 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 26.2 | 1.3e-08 | 234 | 266 | 23 | 55 |
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++ee+ +L++ +gL+++q+ +WF N+R ++ Gh_D08G2181 234 PYPTEEEKLKLSEITGLDQKQINNWFINQRKRH 266 8*****************************885 PP | |||||||
2 | ELK | 35.8 | 1.7e-12 | 186 | 207 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ++K +L+rKYsgyL++L++EF+ Gh_D08G2181 186 DIKGMLMRKYSGYLCNLRKEFL 207 58*******************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 7.6E-17 | 55 | 100 | IPR005540 | KNOX1 |
Pfam | PF03790 | 1.4E-16 | 57 | 99 | IPR005540 | KNOX1 |
SMART | SM01256 | 3.7E-26 | 104 | 155 | IPR005541 | KNOX2 |
Pfam | PF03791 | 2.4E-25 | 107 | 154 | IPR005541 | KNOX2 |
Pfam | PF03789 | 4.8E-8 | 186 | 207 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.057 | 186 | 206 | IPR005539 | ELK domain |
SMART | SM01188 | 2.9E-5 | 186 | 207 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.325 | 206 | 269 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.9E-13 | 208 | 273 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 2.48E-19 | 208 | 278 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 8.6E-27 | 211 | 271 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 6.49E-13 | 218 | 270 | No hit | No description |
Pfam | PF05920 | 1.1E-16 | 226 | 265 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 244 | 267 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 290 aa Download sequence Send to blast |
MEDLYRLDDR TVSSSNDSAR VNNNLAAAVT TTGFHSPVHH LLQFDHQAAD TDMYDVIKTQ 60 IANHPRYPDL VSAHIECRKV VGAPPQLGSL LEEIGRENHH PTSGCSEIGA DPELDDFMES 120 YCEVLHKYKE ELSKPFDEAT TFLSNIESQL SNLCKGALTK TLDYGSDEAC ESSGWEAEAY 180 ESGQEDIKGM LMRKYSGYLC NLRKEFLKKR KKGKLPKDAR MVLLHWWNNH YRWPYPTEEE 240 KLKLSEITGL DQKQINNWFI NQRKRHWKPS EDMKFSLMEG FAGNINGGPT |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 201 | 210 | LRKEFLKKRK |
2 | 207 | 211 | KKRKK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.25004 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX583168 | 6e-72 | JX583168.1 Gossypium hirsutum clone NBRI_GE16149 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016721537.1 | 0.0 | PREDICTED: homeobox protein knotted-1-like 1 | ||||
Swissprot | Q9FP29 | 1e-89 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
TrEMBL | A0A2P5QB66 | 0.0 | A0A2P5QB66_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.004G236400.1 | 0.0 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM835 | 27 | 85 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 1e-73 | KNOTTED1-like homeobox gene 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|