PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1166
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 217aa    MW: 24789.1 Da    PI: 10.2815
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1166genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC42.21.8e-1311120011100
        NF-YC  11 ekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100
                  e++++ k  ++P+ rik+i+k+++    +s ++  l+ ka elf+ ++    +  + + ++++l    ++++v + + +dfl d vp+++
  Gh_D07G1166 111 EEEEEAKVCKFPMNRIKRIIKTEDSHMAVSQDVVFLVNKAAELFLEKFCEDGYKCSIKDRKKSLSYKHLSTVVHEQKRYDFLSDYVPQKK 200
                  677788999****************9*************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.54E-17118198IPR009072Histone-fold
PfamPF008083.4E-14120183IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.6E-22121198IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MASSSKKPKE ENRNKKNKEK SNRTADKDKK KSIKKPEKKA SASKIPTKSK PNPESKPDKS  60
KNQSSNGIPV KSQVIADPSS SSESEPQENR NNSHKNVKPY SKRKRKEEVD EEEEEAKVCK  120
FPMNRIKRII KTEDSHMAVS QDVVFLVNKA AELFLEKFCE DGYKCSIKDR KKSLSYKHLS  180
TVVHEQKRYD FLSDYVPQKK KAEDALKVMN LAETGEG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.208540.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016745372.11e-153PREDICTED: DNA polymerase epsilon subunit C-like
TrEMBLA0A1U8P2E51e-152A0A1U8P2E5_GOSHI; DNA polymerase epsilon subunit C-like
STRINGGorai.001G131300.11e-111(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.16e-32nuclear factor Y, subunit C10