PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D05G3197 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 223aa MW: 25740.5 Da PI: 9.0939 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 167 | 6.3e-52 | 11 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lp+GfrFhP+deelv++yL +kv+ ++ +++ + evd++k+ePwd+p++++ ++kewyf+s+rd+kyatg r+nrat+sgyWkatgkdk+v+s kg+ Gh_D05G3197 11 LPAGFRFHPRDEELVCDYLMRKVALTD--TFQLMIEVDLNKCEPWDIPETARVNSKEWYFYSQRDRKYATGLRTNRATTSGYWKATGKDKAVHS-KGT 105 799********************9988..346799*************88888999**************************************.999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 vg++ktLvfy+grapkg+k+dWvmhe+rl Gh_D05G3197 106 IVGMRKTLVFYHGRAPKGTKSDWVMHEFRL 135 ****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.4E-58 | 3 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 55.174 | 11 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.5E-27 | 12 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 223 aa Download sequence Send to blast |
MSNIRLVEAK LPAGFRFHPR DEELVCDYLM RKVALTDTFQ LMIEVDLNKC EPWDIPETAR 60 VNSKEWYFYS QRDRKYATGL RTNRATTSGY WKATGKDKAV HSKGTIVGMR KTLVFYHGRA 120 PKGTKSDWVM HEFRLQPTSN VSTLKEDWVL CRMLHKTKEI SKNPSIMGSS YDDIASSPLP 180 PLMDSFISFH QPNLDDKYEQ QVPDSPICPQ TKGTLFSPIW TQI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 8e-55 | 6 | 162 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 8e-55 | 6 | 162 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 8e-55 | 6 | 162 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 8e-55 | 6 | 162 | 12 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swm_B | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swm_C | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swm_D | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swp_A | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swp_B | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swp_C | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
3swp_D | 8e-55 | 6 | 162 | 15 | 174 | NAC domain-containing protein 19 |
4dul_A | 8e-55 | 6 | 162 | 12 | 171 | NAC domain-containing protein 19 |
4dul_B | 8e-55 | 6 | 162 | 12 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012441072.1 | 1e-154 | PREDICTED: LOW QUALITY PROTEIN: NAC domain-containing protein 21/22 | ||||
Swissprot | Q84TE6 | 3e-88 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A2P5SK14 | 1e-168 | A0A2P5SK14_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.009G354900.1 | 1e-168 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3619 | 28 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56010.2 | 1e-90 | NAC domain containing protein 1 |