PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_D04G0093 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 171aa MW: 19814.4 Da PI: 9.528 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.2 | 4.3e-19 | 12 | 59 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd +l+++++ +G ++W+tIa++ g++R++k+c++rw +yl Gh_D04G0093 12 KGAWTSEEDTKLAEVIAVHGAKSWNTIASKAGLKRCGKSCRLRWMNYL 59 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.3 | 1.3e-16 | 65 | 110 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ +++E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gh_D04G0093 65 RGNISEQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 110 7899******************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.742 | 7 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.21E-29 | 9 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-14 | 11 | 61 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-17 | 12 | 59 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.5E-24 | 13 | 66 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.57E-9 | 14 | 59 | No hit | No description |
PROSITE profile | PS51294 | 26.066 | 60 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-16 | 64 | 112 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.7E-15 | 65 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-25 | 67 | 115 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.75E-10 | 69 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MGVKKERPQI NKGAWTSEED TKLAEVIAVH GAKSWNTIAS KAGLKRCGKS CRLRWMNYLR 60 PNIKRGNISE QEEDLILRLH KLLGNRWSLI AGRLPGRTDN EIKNYWNSHL SKKIKQKEKQ 120 GCKDEKRSVE NGKEELRQEN TCAAGGEDSN ISFDVDEFFD FSDEKFEWMN R |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-31 | 8 | 114 | 3 | 108 | B-MYB |
1h8a_C | 2e-30 | 8 | 114 | 23 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.8087 | 1e-124 | boll |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to roots and hypocotyl. Specifically expressed in root non-hair developing cells (atrichoblasts) at the N position. Also present in lateral root cap cells. In hypocotyls, expressed within files of epidermal cells located outside a single cortical cell equivalent to roots N cells (at protein level). {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:16207757}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF034131 | 1e-116 | AF034131.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB3) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016718979.1 | 1e-122 | PREDICTED: transcription factor MYB23-like | ||||
Swissprot | Q9SEI0 | 9e-55 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A1U8M0C0 | 1e-121 | A0A1U8M0C0_GOSHI; transcription factor MYB23-like | ||||
STRING | Gorai.012G011700.1 | 1e-120 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G14750.1 | 7e-54 | myb domain protein 66 |