PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A09G2115 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 143aa MW: 15737.8 Da PI: 4.8334 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 167.3 | 1.9e-52 | 21 | 117 | 2 | 98 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 +eqd++lPianv+rimk++lP nakisk+aket+qec+sefisfvt+eas+kc++e+rkt+ngdd++walatlG++dy+ plk yl +yrelege+k Gh_A09G2115 21 KEQDQLLPIANVGRIMKQILPPNAKISKEAKETMQECASEFISFVTGEASEKCKKERRKTVNGDDICWALATLGLDDYAVPLKRYLLRYRELEGEQK 117 79********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.8E-48 | 14 | 123 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.87E-36 | 23 | 122 | IPR009072 | Histone-fold |
Pfam | PF00808 | 8.8E-28 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.2E-16 | 54 | 72 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 57 | 73 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.2E-16 | 73 | 91 | No hit | No description |
PRINTS | PR00615 | 7.2E-16 | 92 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MAENAGTSGT TSNNGNNIGF KEQDQLLPIA NVGRIMKQIL PPNAKISKEA KETMQECASE 60 FISFVTGEAS EKCKKERRKT VNGDDICWAL ATLGLDDYAV PLKRYLLRYR ELEGEQKPAA 120 NHDKVAIVDN CNVEDGDSMG PFI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 3e-41 | 15 | 111 | 1 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016723189.1 | 1e-104 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 2e-54 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A1U8MCA4 | 1e-102 | A0A1U8MCA4_GOSHI; nuclear transcription factor Y subunit B-5-like | ||||
STRING | Gorai.006G263900.1 | 1e-99 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-49 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|