PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A09G0969 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 233aa MW: 26766 Da PI: 7.2187 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.4 | 3.7e-09 | 24 | 70 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 WT Ed+ + ++ +++ g +W++Ia+ ++ g+++k++ +++++ Gh_A09G0969 24 HWTRVEDKVFEQCLVLFPEGisdRWEKIAEQIP-GKSAKEVEQHFHML 70 6********************************.***********976 PP | |||||||
2 | Myb_DNA-binding | 46.6 | 8.1e-15 | 123 | 167 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++l++ + +++G+g+W++I+r + +Rt+ q+ s+ qky Gh_A09G0969 123 PWTEEEHKLFLIGLQKFGKGDWRSISRNVVVTRTPTQVASHAQKY 167 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.1E-6 | 21 | 73 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.38E-10 | 24 | 77 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.5E-8 | 24 | 70 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.2E-5 | 24 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.504 | 25 | 71 | IPR017877 | Myb-like domain |
CDD | cd00167 | 7.43E-8 | 25 | 71 | No hit | No description |
PROSITE profile | PS51294 | 20.829 | 116 | 172 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.9E-17 | 118 | 172 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.0E-17 | 119 | 171 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 120 | 166 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.7E-11 | 120 | 170 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.45E-9 | 123 | 168 | No hit | No description |
Pfam | PF00249 | 9.1E-13 | 123 | 167 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MYQDNNHYNG DPLFIESVAA ATTHWTRVED KVFEQCLVLF PEGISDRWEK IAEQIPGKSA 60 KEVEQHFHML VYDVYEIDAG RVQVPQYADD SVMLSQSWDS HNQISFVSKS KHHGDGERKK 120 GTPWTEEEHK LFLIGLQKFG KGDWRSISRN VVVTRTPTQV ASHAQKYFLR QSAVKKERKR 180 SSIHDITTVD SKTMDVPVEQ NRGSEPHGMV QQATQLQQLP HTGHFVGKYG YPM |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.6850 | 0.0 | leaf| ovule |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016732485.1 | 1e-176 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 7e-60 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A1U8N0A7 | 1e-175 | A0A1U8N0A7_GOSHI; transcription factor DIVARICATA-like | ||||
STRING | Gorai.006G118200.1 | 1e-169 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5127 | 27 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-82 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|