PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A09G0914 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 208aa MW: 24006.5 Da PI: 6.4093 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.8 | 2.8e-09 | 11 | 57 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqk 46 +W+ d+l+ +a ++ ++ +W++Ia+ ++ g+++ +++ ++ + Gh_A09G0914 11 AWSWHQDKLFERALVMFSNDessdRWEKIAAQVP-GKSAADVRRHYED 57 8*********************************.***********76 PP | |||||||
2 | Myb_DNA-binding | 44.1 | 4.8e-14 | 111 | 155 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE+ l++ + +++G+g+W++I+r Rt+ q+ s+ qky Gh_A09G0914 111 PWTEEEHRLFLIGLQKYGKGDWRSISRNAVVSRTPTQVASHAQKY 155 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 7.212 | 7 | 62 | IPR017884 | SANT domain |
SMART | SM00717 | 1.3E-5 | 8 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.9E-9 | 10 | 67 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.59E-5 | 11 | 55 | No hit | No description |
Pfam | PF00249 | 1.7E-7 | 11 | 57 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.214 | 104 | 160 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.89E-17 | 106 | 161 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.3E-10 | 108 | 158 | IPR001005 | SANT/Myb domain |
TIGRFAMs | TIGR01557 | 1.1E-17 | 108 | 158 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.3E-12 | 108 | 154 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.09E-8 | 111 | 156 | No hit | No description |
Pfam | PF00249 | 1.2E-11 | 111 | 155 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MIRTNDDASS AWSWHQDKLF ERALVMFSND ESSDRWEKIA AQVPGKSAAD VRRHYEDLEH 60 DVLEIESGRV ELPSYEGELE SASWVNESGR SQVWVGSKGK ERESERRKGV PWTEEEHRLF 120 LIGLQKYGKG DWRSISRNAV VSRTPTQVAS HAQKYFLRLN SVNEKNKKRS SIHDLKMGDD 180 NSMDPQSKFF NEQGSSFVNN HGYEFPLL |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.26141 | 0.0 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in young seedlings, developing leaves, sepals and trichomes. {ECO:0000269|PubMed:26243618}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX584872 | 4e-94 | JX584872.1 Gossypium hirsutum clone NBRI_GE18283 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016669030.1 | 1e-153 | PREDICTED: transcription factor DIVARICATA-like | ||||
Refseq | XP_017609892.1 | 1e-153 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q9FNN6 | 6e-58 | SRM1_ARATH; Transcription factor SRM1 | ||||
TrEMBL | A0A0B0N539 | 1e-151 | A0A0B0N539_GOSAR; Transcription factor MYB1R1 | ||||
TrEMBL | A0A1U8HSM4 | 1e-151 | A0A1U8HSM4_GOSHI; transcription factor DIVARICATA-like | ||||
TrEMBL | A0A2P5WRK9 | 1e-151 | A0A2P5WRK9_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.006G113100.1 | 1e-144 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM20566 | 5 | 6 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G04760.1 | 1e-61 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|