PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G1254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 693aa    MW: 76965.6 Da    PI: 6.9303
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G1254genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.98.3e-23130230198
                  EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                  f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++el+
  Gh_A07G1254 130 FCKILTASDTSTHGGFSVLRKHATEClppldMNQATPTQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGDNGELR 225
                  99****************************9555556679************************************************..3489999* PP

                  EEEE- CS
           B3  94 vkvfr 98 
                  v+++r
  Gh_A07G1254 226 VGARR 230
                  *9987 PP

2Auxin_resp101.98.4e-34256335183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  aaha++t++ F v+Y+Pr+  s+F++ v+k+++a+k+ +svGmRfkm+fe+ed + rr++Gt+vgv d++p +W++SkWr Lk
  Gh_A07G1254 256 AAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRRFTGTIVGVGDFSP-HWSESKWRTLK 335
                  79****************6..9*************************************************.********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.1E-40121245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.7E-39121259IPR015300DNA-binding pseudobarrel domain
CDDcd100175.42E-19129230No hitNo description
SMARTSM010192.7E-21130232IPR003340B3 DNA binding domain
PROSITE profilePS5086311.702130232IPR003340B3 DNA binding domain
PfamPF023625.9E-21130230IPR003340B3 DNA binding domain
PfamPF065075.0E-31256335IPR010525Auxin response factor
PfamPF023091.1E-7560614IPR033389AUX/IAA domain
SuperFamilySSF542771.37E-12574654No hitNo description
PROSITE profilePS5174527.275578670IPR000270PB1 domain
PfamPF023091.5E-6624668IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MANVQVNPRG SSIAHSESGS SDDDLYAELW KLCAGPLVEI PRNHERVFYF PQGHMELLEA  60
STNQELNNQA PLFNLSSKIL CRVIHVQLLA EQETDDVYAQ ITLQPEPDQS EPTSPDPCPA  120
EAPKRTVQSF CKILTASDTS THGGFSVLRK HATECLPPLD MNQATPTQEL AAKDLHGYEW  180
RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDAFVFLRGD NGELRVGARR LARQQTTMPS  240
SVISSQSMHL GVLATAAHAV TTQTLFVVYY KPRTSQFIIG VNKYLEAIKN GFSVGMRFKM  300
RFEGEDTPDR RFTGTIVGVG DFSPHWSESK WRTLKIQWDE PATIQRPERV SPWEIEPFAP  360
SASVNLVQPS VKNKRPRPVD IPVSEITTNS AGSTFWGRGS TQSHELTQVG STPEIQSSES  420
QVIWGMRQKE ADYSRGYNSN AWPHSPLVNV SLNLFPNSVS DKNRTEKPQT TLTGYALPSL  480
SRPSKGLMHD QVEKGKKSEI STGCRLFGFN LTDTISAVIP TDKEQTNTTV DHNGVWGSLA  540
AASHIDQNPE TAKQKHVAAE ASSKEMQAKQ GASTTSTRSR TKVQMQGIAV GRAVDLTVLK  600
GYDDLINEVE KMFDIKGELR PSGKWSVVFT DDEGDMMLVG DDPWMDFCKM VRKIFIYSSE  660
EVNKISPRCK FAVSSLDGEG TAVTIDSEHK SET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1711935813355Auxin response factor 1
4ldw_A1e-1711935813355Auxin response factor 1
4ldw_B1e-1711935813355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1373377KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.190128e-37boll| ovule
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016743659.10.0PREDICTED: auxin response factor 11-like
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A1U8P0C50.0A0A1U8P0C5_GOSHI; Auxin response factor
STRINGGorai.001G153900.10.0(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]