PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A06G1758 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 190aa MW: 21941.8 Da PI: 5.0039 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 87.2 | 3.1e-27 | 5 | 128 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv...ePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 ppG+rF+Ptd el+++yL kkv+g++l+ ++i+e++iy ePw+ ++++++ y F+k +k + +gk+ r++ g+Wk + + +++ + Gh_A06G1758 5 PPGYRFEPTDVELLQDYLWKKVNGEPLPY-NIISECEIYGNqdkEPWNVF--IETSTETFYVFTKLKK-KGKGKNIDRVAGCGTWKGQKT-DPIMY-E 96 9****************************.89*****99644449****6..5565566677777655.578**************8865.67887.7 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 + ++g +k +v+ + +++g+k +W+mhe++l Gh_A06G1758 97 KMKIGNRKLFVYEVKGSNEGVKGHWIMHEFSL 128 899**********9999*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.48E-31 | 2 | 147 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 30.003 | 4 | 147 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.4E-18 | 5 | 128 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MTGIPPGYRF EPTDVELLQD YLWKKVNGEP LPYNIISECE IYGNQDKEPW NVFIETSTET 60 FYVFTKLKKK GKGKNIDRVA GCGTWKGQKT DPIMYEKMKI GNRKLFVYEV KGSNEGVKGH 120 WIMHEFSLVD EEDKQIGDYV VCSIRNKNAK DDTDEEEPPM KKMRFNSEDH NPPETTSSAC 180 PLQTLLSDWS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-21 | 4 | 149 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-21 | 4 | 149 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-21 | 4 | 149 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-21 | 4 | 149 | 17 | 167 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swm_B | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swm_C | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swm_D | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swp_A | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swp_B | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swp_C | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
3swp_D | 4e-21 | 4 | 149 | 20 | 170 | NAC domain-containing protein 19 |
4dul_A | 4e-21 | 4 | 149 | 17 | 167 | NAC domain-containing protein 19 |
4dul_B | 4e-21 | 4 | 149 | 17 | 167 | NAC domain-containing protein 19 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016752791.1 | 1e-140 | PREDICTED: NAC domain-containing protein 41-like | ||||
TrEMBL | A0A1U8PNM9 | 1e-139 | A0A1U8PNM9_GOSHI; NAC domain-containing protein 41-like | ||||
STRING | Gorai.010G251100.1 | 1e-120 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13343 | 7 | 27 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G10490.1 | 3e-21 | NAC domain containing protein 52 |