PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G3429
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YC
Protein Properties Length: 306aa    MW: 33508.1 Da    PI: 5.7769
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G3429genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC59.29.1e-196861898
        NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                 ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  + +   +t++   ++ +v++ ++fdfl +iv r
  Gh_A05G3429  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYKITLQRGAKTMNSLHLKHCVQSYNVFDFLREIVSR 86
                 5789*************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.0E-26372IPR009072Histone-fold
SuperFamilySSF471133.1E-20490IPR009072Histone-fold
PfamPF008088.3E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YKITLQRGAK  60
TMNSLHLKHC VQSYNVFDFL REIVSRVPDY GHGHGHGHSD AVAAAADDDR SISRRRKAAG  120
DEVHDSDEES KRSRIHDVGH VGTIGRGRGR GRGRGRGRGG RNVERDAHRE IEPEPCATLQ  180
QNSKSHPTPG MLVDDGSESK EPIKENTIAE DANQAVRNFD LNAEVDENVE AKPTVGAATA  240
AAPEPATAAA AAAAQPSSAE SITETKHEEY PGWSLSDMDK MAIDPLQLAQ LGKRLDEYEE  300
DYDEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-20272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147157RGRGRGRGRGR
2149158RGRGRGRGRG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.30050.0boll| ovule
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX9644481e-126JX964448.1 Gossypium hirsutum clone NBRI_TRANS-717 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012458388.11e-167PREDICTED: dr1-associated corepressor homolog isoform X2
RefseqXP_016714188.11e-167PREDICTED: dr1-associated corepressor homolog
TrEMBLA0A0D2TH631e-166A0A0D2TH63_GOSRA; Uncharacterized protein
TrEMBLA0A1U8LL521e-166A0A1U8LL52_GOSHI; dr1-associated corepressor homolog
STRINGGorai.012G022300.11e-167(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.18e-63nuclear factor Y, subunit C11