PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A05G0291 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 199aa MW: 23148.2 Da PI: 7.9739 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 66.7 | 4.2e-21 | 17 | 64 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+++v+ +G+++Wk++a++ g++R++k+c++rw +yl Gh_A05G0291 17 RGAWTAEEDQKLAQVVEIHGPKRWKAVAAKAGLNRCGKSCRLRWMNYL 64 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.8 | 3.9e-16 | 70 | 115 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l Gh_A05G0291 70 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 115 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.575 | 12 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.27E-30 | 15 | 111 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-17 | 16 | 66 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.6E-20 | 17 | 64 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-25 | 18 | 71 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.01E-12 | 19 | 64 | No hit | No description |
SMART | SM00717 | 1.9E-15 | 69 | 117 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.918 | 69 | 119 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.6E-14 | 70 | 115 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.8E-25 | 72 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.08E-9 | 74 | 115 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MPMAPTSTKC SKKEVNRGAW TAEEDQKLAQ VVEIHGPKRW KAVAAKAGLN RCGKSCRLRW 60 MNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNEIKNY WNSHLSKKIK 120 QNEKQTRMQE PVLENSKVSE REEPLHKASE EGSSKRDEEY STSCFNGDSS LFDLYNEEPL 180 ELEWMSHFFE TDEIWLNLA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 5e-31 | 14 | 119 | 1 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 1e-30 | 14 | 119 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Siliques. {ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1 or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX582297 | 4e-69 | JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016753002.1 | 1e-147 | PREDICTED: transcription factor MYB114-like | ||||
Refseq | XP_017646585.1 | 1e-147 | PREDICTED: transcription factor MYB114-like | ||||
Swissprot | P10290 | 1e-52 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
Swissprot | Q38850 | 6e-53 | MYB5_ARATH; Transcription repressor MYB5 | ||||
TrEMBL | A0A1U8PPB7 | 1e-146 | A0A1U8PPB7_GOSHI; transcription factor MYB114-like | ||||
TrEMBL | A0A2P5WPG5 | 1e-146 | A0A2P5WPG5_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.009G040800.1 | 1e-145 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G13540.1 | 3e-55 | myb domain protein 5 |