PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A04G0770 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 119aa MW: 13690.3 Da PI: 5.6366 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 27.6 | 6.2e-09 | 64 | 108 | 4 | 48 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 k++ r +N A rsR+RKk++++ Le k+ Le+e ++L Gh_A04G0770 64 AKKQSRQLRNGDATVRSRERKKMYVKDLEMKSRYLEEECRRLSRV 108 699***********************************9999765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 7.4E-9 | 57 | 115 | No hit | No description |
PROSITE profile | PS50217 | 8.657 | 63 | 119 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.1E-7 | 64 | 109 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.44E-8 | 65 | 116 | No hit | No description |
CDD | cd14704 | 2.65E-11 | 66 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MVLMEDDNFD HRVETQLVPN NDFLADLLVD SPPCSSNDVV GADSGDLHKH SQTHTDVNKD 60 DPIAKKQSRQ LRNGDATVRS RERKKMYVKD LEMKSRYLEE ECRRLSRVLQ CFIAESQAL |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Ghi.2157 | 1e-117 | boll| ovule| root| stem |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016717198.1 | 5e-84 | PREDICTED: bZIP transcription factor 60-like | ||||
Swissprot | Q69XV0 | 1e-21 | BZP50_ORYSJ; bZIP transcription factor 50 | ||||
TrEMBL | A0A1U8LUU4 | 1e-82 | A0A1U8LUU4_GOSHI; bZIP transcription factor 60-like | ||||
STRING | Gorai.009G309200.1 | 2e-63 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4634 | 28 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 6e-16 | basic region/leucine zipper motif 60 |
Publications ? help Back to Top | |||
---|---|---|---|
|