PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A03G1745 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 208aa MW: 22988.8 Da PI: 8.7015 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 101.2 | 1.9e-31 | 13 | 72 | 3 | 62 |
DUF702 3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaassk 62 g+++CqdCGnqakkdC+++RCRtCC+s+gf+C+th+kstWvpa++rr+r++++++++ Gh_A03G1745 13 GGGTRCQDCGNQAKKDCNYMRCRTCCRSKGFECQTHIKSTWVPAYRRRHRHHHQHQQQPL 72 57789********************************************96665554332 PP | |||||||
2 | DUF702 | 75.4 | 1.7e-23 | 80 | 144 | 93 | 154 |
DUF702 93 saeskkeletsslPeevsseavfrcvrvssvdd...geeelaYqtavsigGhvfkGiLydqGlee 154 ++++++ le+ ++P+ev s+a frcvrv s++d g +++aY+tav igGhvfkGiLydqG+++ Gh_A03G1745 80 RENPSSGLEVGDFPAEVTSPATFRCVRVCSMEDttaGGDQYAYRTAVMIGGHVFKGILYDQGPDQ 144 456677889999*********************6666789***********************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 2.1E-50 | 15 | 143 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 3.0E-27 | 18 | 59 | IPR006510 | Zinc finger, lateral root primordium type 1 |
TIGRFAMs | TIGR01624 | 9.2E-23 | 92 | 142 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MMMSSRGYGG GTGGGTRCQD CGNQAKKDCN YMRCRTCCRS KGFECQTHIK STWVPAYRRR 60 HRHHHQHQQQ PLQHNPKRLR ENPSSGLEVG DFPAEVTSPA TFRCVRVCSM EDTTAGGDQY 120 AYRTAVMIGG HVFKGILYDQ GPDQGHYSLG ECSSRETPLQ QPNQALTMAT ANTATASATE 180 TLLPFAYPSP FNAAFMSAGT QFFLHPKS |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in the apical parts of the developing gynoecium. Detected throughout the youngest flower primordium. Later relocalizes towards the regions of the presumptive sepal anlagen and remains in sepal primordia until just after their emergence. Also observed on the abaxial side of the young floral meristem. Present in the newly arisen gynoecial primordium. Restricted to the apical parts of the carpels as the open-ended gynoecial cylinder elongates vertically. In the apical regions of the gynoecium, confined to a zone in the interphase between the style and the stigma and fades out later. Within the gynoecium, accumulates in ovule primordia, and, as the ovules developed, restricted to the epidermis of the developing funiculi, to the outer, but not the inner, integuments and to the tip of the nucellus. Also present in the cell layer of the septum that faces the ovary. In the embryo, detected in the cotyledon primordia during late globular to mid heart stage. In addition, transiently expressed in petal and stamen primordia and in the tapetum of the anthers. {ECO:0000269|PubMed:12361963}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers, seeds and seedlings. {ECO:0000269|PubMed:12361963}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:12361963, ECO:0000269|PubMed:16740145, ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18811619, ECO:0000269|PubMed:20154152, ECO:0000269|PubMed:22318676}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Regulated by ESR1 and ESR2. {ECO:0000269|PubMed:21976484}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX579311 | 1e-100 | JX579311.1 Gossypium hirsutum clone NBRI_GE11521 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016714518.1 | 1e-157 | PREDICTED: protein SHI RELATED SEQUENCE 3-like | ||||
Swissprot | Q9SD40 | 3e-53 | SRS1_ARATH; Protein SHI RELATED SEQUENCE 1 | ||||
TrEMBL | A0A1U8LM36 | 1e-156 | A0A1U8LM36_GOSHI; protein SHI RELATED SEQUENCE 3-like | ||||
TrEMBL | A0A2P5XRE8 | 1e-156 | A0A2P5XRE8_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.005G247100.1 | 1e-152 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9188 | 26 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G51060.1 | 4e-47 | Lateral root primordium (LRP) protein-related |
Publications ? help Back to Top | |||
---|---|---|---|
|