PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A03G1081 | ||||||||
Common Name | WRKY8 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 180aa MW: 20423 Da PI: 9.774 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.1 | 6.5e-32 | 97 | 155 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG K vk+s+fprsYYrCt++gC+vkk+v+r ++d+ +ve+tYeg H h+ Gh_A03G1081 97 LDDGYRWRKYGHKAVKNSKFPRSYYRCTHQGCKVKKQVQRLTKDEGIVETTYEGMHSHP 155 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.7E-33 | 82 | 155 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 7.32E-29 | 89 | 156 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.288 | 92 | 157 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.0E-37 | 97 | 156 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.3E-26 | 98 | 155 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 180 aa Download sequence Send to blast |
MENFQGFFPT SSSSSTSLSL NLTSSLGYSE FECGKDNDGI LGLMADIKVG GATNENNSLV 60 GTTTESEVKI GKTKKGENKK IRKPRYAFQT RSQVDILDDG YRWRKYGHKA VKNSKFPRSY 120 YRCTHQGCKV KKQVQRLTKD EGIVETTYEG MHSHPIQKTN DNFEHILNQM QIYTSFKSII |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-25 | 87 | 154 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-25 | 87 | 154 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF031073 | 0.0 | KF031073.1 Gossypium hirsutum WRKY transcription factor 8 (WRKY8) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016665779.1 | 1e-133 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_017636437.1 | 1e-133 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 1e-52 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A1U8HR27 | 1e-132 | A0A1U8HR27_GOSHI; probable WRKY transcription factor 75 | ||||
TrEMBL | A0A2P5X7Z3 | 1e-132 | A0A2P5X7Z3_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.005G164300.1 | 1e-114 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 3e-54 | WRKY DNA-binding protein 75 |