PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Gh_A01G1273 | ||||||||
Common Name | WRKY15 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 150aa MW: 17366.7 Da PI: 10.1378 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 104.9 | 4.2e-33 | 70 | 128 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+++r ++d+ +v++tYeg H h+ Gh_A01G1273 70 LDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQIQRLTKDEGMVVTTYEGMHSHP 128 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.7E-34 | 55 | 129 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 8.11E-30 | 62 | 129 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.907 | 65 | 130 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.6E-38 | 70 | 129 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-26 | 71 | 128 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MENFQGFLTT SSLLGYGEFQ SGKGLMEEME GGAENKTFAG LLGTQKKKGD RKKIRKPRYA 60 FQTRSKVDIL DDGYRWRKYG QKAVKNNKFP RSYYRCTHQG CNVKKQIQRL TKDEGMVVTT 120 YEGMHSHPIQ NSNDNFDHIL SQMQIYTTSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-28 | 61 | 127 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-28 | 61 | 127 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 49 | 56 | DRKKIRKP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF669833 | 0.0 | KF669833.1 Gossypium hirsutum WRKY transcription factor 15 (WRKY15) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016701946.1 | 1e-110 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 1e-53 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | A0A068LDA3 | 1e-109 | A0A068LDA3_GOSHI; WRKY transcription factor 15 | ||||
STRING | Gorai.002G181600.1 | 1e-106 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 3e-55 | WRKY DNA-binding protein 75 |