PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS74409.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB

Protein Properties

Length: 150aa MW: 17336.9 Da PI: 9.5549

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS74409.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	64	2.9e-20	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+lv++++++G g+W++ ++ g++R++k+c++rw +yl EPS74409.1 14 KGPWTPEEDEKLVEYIRKHGHGSWRALPKFAGLNRCGKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	58.5	1.5e-18	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++++eE+e +++++ lG++ W++Ia +++ gRt++++k++w+++l EPS74409.1 67 RGKFSQEEEETILNLHSILGNK-WSAIATHLP-GRTDNEIKNFWNTHL 112 89******************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.8E-28	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	19.542	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	3.05E-33	11	108	IPR009057	Homeodomain-like
SMART	SM00717	1.3E-16	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	6.7E-19	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	1.23E-12	16	61	No hit	No description
PROSITE profile	PS51294	27.142	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-28	65	117	IPR009057	Homeodomain-like
SMART	SM00717	5.9E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	5.4E-17	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	8.55E-12	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MGRSPCCDES GLKKGPWTPE EDEKLVEYIR KHGHGSWRAL PKFAGLNRCG KSCRLRWTNY 60 LRPDIKRGKF SQEEEETILN LHSILGNKWS AIATHLPGRT DNEIKNFWNT HLKKKLIQMG 120 YDPVTHQPRT DFFSSLPHLI ALATLKEIVE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-31	12	116	5	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00180	DAP	Transfer from AT1G34670	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021635031.1	1e-102	transcription factor MYB41-like isoform X2
Refseq	XP_028056542.1	1e-101	transcription factor MYB93-like
Refseq	XP_028069886.1	1e-101	transcription factor MYB93-like
Swissprot	Q9S9Z2	3e-97	MYB93_ARATH; Transcription factor MYB93
TrEMBL	S8D3W5	1e-108	S8D3W5_9LAMI; Uncharacterized protein (Fragment)
STRING	POPTR_0005s07590.1	1e-100	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12	24	2154

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34670.1	1e-99	myb domain protein 93

Publications ? help Back to Top
Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]