PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS74236.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family SBP
Protein Properties Length: 109aa    MW: 12040.1 Da    PI: 10.2968
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS74236.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP124.83.5e-392195276
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
         SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
                Cqv+gC +dl+e+k ++ rhkvC +hsk+++vl++g+e rfCqqCsrfh+l efD+ekrsCrr+La hn+rrrk 
  EPS74236.1 21 CQVDGCGVDLAETKGFYCRHKVCPMHSKCAAVLIAGVEMRFCQQCSRFHQLAEFDKEKRSCRRKLAAHNQRRRKI 95
                *************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-311482IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.4791895IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.15E-361998IPR004333Transcription factor, SBP-box
PfamPF031101.1E-312194IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
KKSKSSAVGA VQYGGKAPPK CQVDGCGVDL AETKGFYCRH KVCPMHSKCA AVLIAGVEMR  60
FCQQCSRFHQ LAEFDKEKRS CRRKLAAHNQ RRRKIPPGEA MVASIFGNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-291494484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18192RRKLAAHNQRRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391832.19e-41PREDICTED: squamosa promoter-binding-like protein 14
SwissprotQ700W22e-36SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBLS8D9M62e-74S8D9M6_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_08s0007g06270.t013e-39(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.11e-38squamosa promoter binding protein-like 9
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]
  3. Stief A, et al.
    Arabidopsis miR156 Regulates Tolerance to Recurring Environmental Stress through SPL Transcription Factors.
    Plant Cell, 2014. 26(4): p. 1792-1807
    [PMID:24769482]
  4. Yu ZX, et al.
    Progressive Regulation of Sesquiterpene Biosynthesis in Arabidopsis and Patchouli (Pogostemon cablin) by the miR156-Targeted SPL Transcription Factors.
    Mol Plant, 2015.
    [PMID:25355059]
  5. Yu N,Niu QW,Ng KH,Chua NH
    The role of miR156/SPLs modules in Arabidopsis lateral root development.
    Plant J., 2015. 83(4): p. 673-85
    [PMID:26096676]
  6. Morea EG, et al.
    Functional and evolutionary analyses of the miR156 and miR529 families in land plants.
    BMC Plant Biol., 2016. 16: p. 40
    [PMID:26841873]
  7. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  8. Xu M, et al.
    Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(8): p. e1006263
    [PMID:27541584]
  9. Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ
    The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses.
    Front Plant Sci, 2016. 7: p. 1548
    [PMID:27790239]
  10. Mao YB, et al.
    Jasmonate response decay and defense metabolite accumulation contributes to age-regulated dynamics of plant insect resistance.
    Nat Commun, 2017. 8: p. 13925
    [PMID:28067238]
  11. Nguyen ST,Greaves T,McCurdy DW
    Heteroblastic Development of Transfer Cells Is Controlled by the microRNA miR156/SPL Module.
    Plant Physiol., 2017. 173(3): p. 1676-1691
    [PMID:28082719]
  12. Duan HC, et al.
    ALKBH10B Is an RNA N6-Methyladenosine Demethylase Affecting Arabidopsis Floral Transition.
    Plant Cell, 2017. 29(12): p. 2995-3011
    [PMID:29180595]
  13. Dotto M,Gómez MS,Soto MS,Casati P
    UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana.
    Plant Cell Environ., 2018. 41(6): p. 1394-1406
    [PMID:29447428]
  14. He J, et al.
    Threshold-dependent repression of SPL gene expression by miR156/miR157 controls vegetative phase change in Arabidopsis thaliana.
    PLoS Genet., 2018. 14(4): p. e1007337
    [PMID:29672610]