PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

EPS72941.1

Organism

Genlisea aurea

Taxonomic ID

192259

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea

Family

MYB

Protein Properties

Length: 118aa MW: 14114.2 Da PI: 11.2078

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
EPS72941.1	genome	LSMU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54	3.7e-17	5	50	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l ++v+ +G+ +W++Ia++++ gR++k+c++rw++ EPS72941.1 5 RGHWKPSEDAKLRELVAVFGPQNWNLIAEKLQ-GRSGKSCRLRWYNQ 50 899***************************.**********96 PP
2	Myb_DNA-binding	57.2	3.7e-18	57	101	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++++eE+ +lv+a++ +G++ W++I+r ++ gRt++ +k++w+ + EPS72941.1 57 RTAFSEEEEVRLVEAHRAYGNK-WALISRLFP-GRTDNAVKNHWHVL 101 678*****************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	26.644	1	55	IPR017930	Myb domain
SMART	SM00717	2.2E-14	4	53	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	5.86E-29	5	102	IPR009057	Homeodomain-like
Pfam	PF00249	7.7E-17	5	51	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	7.7E-27	6	58	IPR009057	Homeodomain-like
CDD	cd00167	1.25E-11	8	49	No hit	No description
SMART	SM00717	6.0E-15	56	104	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	21.58	56	106	IPR017930	Myb domain
Pfam	PF00249	2.1E-15	57	101	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.7E-20	59	106	IPR009057	Homeodomain-like
CDD	cd00167	1.75E-9	59	102	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 118 aa Download sequence Send to blast
KYCTRGHWKP SEDAKLRELV AVFGPQNWNL IAEKLQGRSG KSCRLRWYNQ LDPRINRTAF 60 SEEEEVRLVE AHRAYGNKWA LISRLFPGRT DNAVKNHWHV LMARRIREKS KPNYVRRR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-34	4	106	6	108	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021605698.1	5e-67	transcription factor MYB105-like
Swissprot	Q5NBM8	4e-65	CSA_ORYSJ; Transcription factor CSA
TrEMBL	S8D6B4	4e-82	S8D6B4_9LAMI; Uncharacterized protein (Fragment)
STRING	XP_006482676.1	1e-65	(Citrus sinensis)
STRING	cassava4.1_028014m	4e-66	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1684	24	70

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69560.1	2e-66	myb domain protein 105

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Leushkin EV, et al. The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences. BMC Genomics, 2013. 14: p. 476 [PMID:23855885] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420]