PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS72847.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 147aa MW: 16167.5 Da PI: 10.2823 | ||||||||
Description | NF-YC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 62 | 1.2e-19 | 9 | 88 | 18 | 97 |
NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 ++++P arikki++adedv +i+ +Pvl+ska elf+ +l r++ + + +t+ ++++v++ ++fdfl ++v EPS72847.1 9 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYGVTVQRGAKTVSSLHLKQCVQSYNVFDFLKEVVS 88 5789************************************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-26 | 6 | 75 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.46E-20 | 7 | 91 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-19 | 11 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005829 | Cellular Component | cytosol | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
ACIMRKKLDT RFPAARIKKI MQADEDVGKI AMAVPVLVSK ALELFLQDLC DRTYGVTVQR 60 GAKTVSSLHL KQCVQSYNVF DFLKEVVSNV PEFGISEGAS DSSKRRKVLP NESHDSDQES 120 KRGISQETCH SSGVGRGRGR GRGRGRG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_A | 1e-24 | 5 | 75 | 5 | 75 | Transcription Regulator NC2 alpha chain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 135 | 145 | RGRGRGRGRGR |
2 | 137 | 146 | RGRGRGRGRG |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020553014.1 | 6e-74 | dr1-associated corepressor-like isoform X2 | ||||
Swissprot | A0JPP1 | 3e-30 | NC2A_RAT; Dr1-associated corepressor | ||||
Swissprot | Q14919 | 3e-30 | NC2A_HUMAN; Dr1-associated corepressor | ||||
Swissprot | Q2YDP3 | 3e-30 | NC2A_BOVIN; Dr1-associated corepressor | ||||
TrEMBL | S8EJV8 | 1e-103 | S8EJV8_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.N01867.1.p | 6e-71 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7960 | 22 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12480.1 | 2e-62 | nuclear factor Y, subunit C11 |
Publications ? help Back to Top | |||
---|---|---|---|
|