PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS72726.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 120aa MW: 14119.2 Da PI: 10.2561 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 61.7 | 1.5e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEde+lv ++k++G g+W++ ++ g+ R++k+c++rw +yl EPS72726.1 14 RGKWSAEEDEKLVSYIKKHGEGNWRSLPHNAGLLRCGKSCRLRWMNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 59.8 | 5.8e-19 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T++E+e++v ++++lG++ W++Ia+ ++ gRt++++k++w+++l EPS72726.1 67 RGNFTPDEEEIIVVLHNMLGNK-WALIAKQLP-GRTDNDIKNYWNSHL 112 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.247 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.31E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 15 | 68 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.34E-11 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 25.716 | 62 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.7E-17 | 67 | 112 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.0E-27 | 69 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.40E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0051555 | Biological Process | flavonol biosynthetic process | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MGRKACCDKT GLKRGKWSAE EDEKLVSYIK KHGEGNWRSL PHNAGLLRCG KSCRLRWMNY 60 LRSDLKRGNF TPDEEEIIVV LHNMLGNKWA LIAKQLPGRT DNDIKNYWNS HLSRRLYEFR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-28 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis primarily in cotyledons and leaves (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00598 | PBM | Transfer from AT5G49330 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Triggered by HY5 in response to light and UV-B. {ECO:0000269|PubMed:19895401}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012840518.1 | 4e-64 | PREDICTED: transcription repressor MYB6 | ||||
Refseq | XP_027115935.1 | 6e-64 | transcription factor MYB11-like isoform X1 | ||||
Swissprot | Q9FJ07 | 2e-62 | MY111_ARATH; Transcription factor MYB111 | ||||
TrEMBL | S8D5L7 | 2e-83 | S8D5L7_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Migut.N00057.1.p | 1e-63 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 8e-65 | myb domain protein 111 |