PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS72475.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 147aa MW: 16756.2 Da PI: 10.2977 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.1 | 4.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv++++ +G+g+W+ +r g+ R++k+c++rw +yl EPS72475.1 14 KGPWTAEEDAKLVQYIQIHGPGNWRILPRNAGLQRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 54.8 | 2.2e-17 | 67 | 111 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rgr++ +E+e +++++ lG++ W++Ia++++ gRt++++k++w+++ EPS72475.1 67 RGRFSFDEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111 89********************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.3E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 25.481 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.16E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.3E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.57E-11 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.8E-26 | 65 | 116 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.869 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.9E-16 | 67 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.42E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MGRSPCCDKD GLKKGPWTAE EDAKLVQYIQ IHGPGNWRIL PRNAGLQRCG KSCRLRWTNY 60 LRPDIKRGRF SFDEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRIG 120 IDPITHGPRL DIFDLSSILA SSSSSSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 9e-30 | 12 | 116 | 2 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 8e-30 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 8e-30 | 12 | 116 | 2 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:19517001, ECO:0000305|PubMed:12857823}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269|PubMed:12857823, ECO:0000269|PubMed:19517001, ECO:0000269|PubMed:8980549}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021276916.1 | 2e-93 | transcription factor MYB41-like | ||||
Swissprot | Q9LDR8 | 3e-92 | MY102_ARATH; Transcription factor MYB102 | ||||
TrEMBL | S8CZH7 | 1e-104 | S8CZH7_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_008455362.1 | 2e-92 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G21440.1 | 1e-88 | MYB-like 102 |
Publications ? help Back to Top | |||
---|---|---|---|
|