PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS71765.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 211aa MW: 23597.9 Da PI: 10.3842 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.2 | 8e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +l+ +++++G g+W++ +++ g+ R++k+c++rw +yl EPS71765.1 14 KGPWTPEEDHKLLAYIEEHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l EPS71765.1 67 RGKFTLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-26 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 17.362 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.67E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.0E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.13E-10 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 26.333 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.2E-27 | 65 | 116 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.8E-17 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.3E-17 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.11E-12 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000902 | Biological Process | cell morphogenesis | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 211 aa Download sequence Send to blast |
MGRSPCCDKV GLKKGPWTPE EDHKLLAYIE EHGHGSWRAL PAKAGLQRCG KSCRLRWTNY 60 LRPDIKRGKF TLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLTKMG 120 IDPVTHTPKN DALLSNDGQA KSAANLSHMA QWESARLEAE ARLVRQSKLR SAGSTSAQMQ 180 HHGAAVDQPA RCLDVLKAWS GGVAWGKAND V |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-27 | 12 | 116 | 5 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018813959.1 | 1e-127 | PREDICTED: snRNA-activating protein complex subunit 4-like | ||||
Refseq | XP_019233894.1 | 1e-127 | PREDICTED: transcription factor MYB34-like | ||||
Swissprot | Q9LE63 | 1e-109 | MY106_ARATH; Transcription factor MYB106 | ||||
TrEMBL | S8CXQ7 | 1e-155 | S8CXQ7_9LAMI; Protein 1 (Fragment) | ||||
STRING | XP_009624863.1 | 1e-126 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12 | 24 | 2154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15310.1 | 1e-111 | myb domain protein 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|